Citrus Sinensis ID: 028768


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MASMDPNLNTNIDELVSVQSPPSEKPKLCLVWNEHYPPGFLRKVIAEIIATYLLVFVTCGSAALSAYDEHRVSKLGASVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAAVRHFPWKQVPIYAAAQLTGAVSASLTLRVLLHPIKHIGTTSPSGSDLQALIMEIVVTFSMMFVTSAVATDTKAIGELAGIAVGSAVCITSVLAG
cccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHEEEcccccccccHHHHHHHHHHHHHHHcc
**************************KLCLVWNEHYPPGFLRKVIAEIIATYLLVFVTCGSAALSAYDEHRVSKLGASVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAAVRHFPWKQVPIYAAAQLTGAVSASLTLRVLLHPIKHIGTTSPSGSDLQALIMEIVVTFSMMFVTSAVATDTKAIGELAGIAVGSAVCITSVLAG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASMDPNLNTNIDELVSVQSPPSEKPKLCLVWNEHYPPGFLRKVIAEIIATYLLVFVTCGSAALSAYDEHRVSKLGASVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAAVRHFPWKQVPIYAAAQLTGAVSASLTLRVLLHPIKHIGTTSPSGSDLQALIMEIVVTFSMMFVTSAVATDTKAIGELAGIAVGSAVCITSVLAG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aquaporin NIP2-2 Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.probableQ67WJ8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IYZ, chain A
Confidence level:confident
Coverage over the Query: 36-204
View the alignment between query and template
View the model in PyMOL