Citrus Sinensis ID: 028772


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MAVEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKVPVVKFDDKWVADSDVIVRIIEEKYPEPSLTNPPEFASLGSKIFPSFVNFLKSKDPNDGTEQALLEELKALDEHLKTHGGPFIAGEKVTAVDLSLAPKLYHLQVALEHFKQWTVPESLAHVHGYTKDGCRRSMHELVLSYAVFEI
ccEEEEEEEccccccccccccHHHHHHHHHHHcccccEEEEEccccccHHHHHHcccccccEEEEccEEEEEHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccHHHHHHHccccccc
ccEEEEEEEccccccccccccHHHHHHEEEHHcccEEEEEEEcccccHHHHHHHcccccccEEEEcccEcccHHHHHHHHHHHcccccccccccHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHccccccccccEcHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc
MAVEICVKAAvgapdilgdcpfSQRALLTLeekkvpykrhlinisdkpqwfmeispegkvpvvkfddkwvadSDVIVRIIEekypepsltnppefaslgskifpSFVNflkskdpndgtEQALLEELKALDEHLkthggpfiagekvtavdlslaPKLYHLQVALEHfkqwtvpeslahvhgytkdgcrrSMHELVLSYAVFEI
MAVEICVKaavgapdilgdCPFSQRALLTleekkvpykrhlinisdkpqwfmeISPEGKVPVVKFDDKWVADSDVIVRIIEekypepsltnppEFASLGSKIFPSFVNFLKSKDPNDGTEQALLEELKALDEHLKTHGGPFIAGEKVTAVDLSLAPKLYHLQVALEHFKQWTVPESLAHVHGYTKDGCRRSMHELVLSYAVFEI
MAVEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKVPVVKFDDKWVADSDVIVRIIEEKYPEPSLTNPPEFASLGSKIFPSFVNFLKSKDPNDGTEQALLEELKALDEHLKTHGGPFIAGEKVTAVDLSLAPKLYHLQVALEHFKQWTVPESLAHVHGYTKDGCRRSMHELVLSYAVFEI
**VEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKVPVVKFDDKWVADSDVIVRIIEEKY***********ASLGSKIFPSFVNFL***************ELKALDEHLKTHGGPFIAGEKVTAVDLSLAPKLYHLQVALEHFKQWTVPESLAHVHGYTKDGCRRSMHELVLSYAVF**
*AVEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKVPVVKFDDKWVADSDVIVRIIEEKYPEPSLTNPPEFASLGSKIFPSFVNFLK**********ALLEELKALDEHLKTHGGPFIAGEKVTAVDLSLAPKLYHLQVALEHFKQWTVPESLAHVHGYTKDGCRRSMHELVLSYAVFEI
MAVEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKVPVVKFDDKWVADSDVIVRIIEEKYPEPSLTNPPEFASLGSKIFPSFVNFLKSKDPNDGTEQALLEELKALDEHLKTHGGPFIAGEKVTAVDLSLAPKLYHLQVALEHFKQWTVPESLAHVHGYTKDGCRRSMHELVLSYAVFEI
*AVEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKVPVVKFDDKWVADSDVIVRIIEEKYPEPSLTNPPEFASLGSKIFPSFVNFLKSKDPNDGTEQALLEELKALDEHLKTHGGPFIAGEKVTAVDLSLAPKLYHLQVALEHFKQWTVPESLAHVHGYTKDGCRRSMHELVLSYA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKVPVVKFDDKWVADSDVIVRIIEEKYPEPSLTNPPEFASLGSKIFPSFVNFLKSKDPNDGTEQALLEELKALDEHLKTHGGPFIAGEKVTAVDLSLAPKLYHLQVALEHFKQWTVPESLAHVHGYTKDGCRRSMHELVLSYAVFEI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query204 2.2.26 [Sep-21-2011]
Q9FRL8213 Glutathione S-transferase yes no 0.950 0.910 0.747 2e-83
Q9FWR4213 Glutathione S-transferase no no 0.906 0.868 0.762 4e-79
Q9FG59217 Putative glutathione S-tr no no 0.906 0.852 0.698 6e-71
Q8LE52258 Glutathione S-transferase no no 0.916 0.724 0.611 2e-66
O00299241 Chloride intracellular ch yes no 0.911 0.771 0.284 4e-18
Q9Z1Q5241 Chloride intracellular ch yes no 0.911 0.771 0.284 5e-18
Q6MG61241 Chloride intracellular ch yes no 0.911 0.771 0.284 5e-18
Q5E9B7241 Chloride intracellular ch yes no 0.911 0.771 0.274 3e-17
Q95MF9241 Chloride intracellular ch yes no 0.911 0.771 0.284 8e-17
Q9Z0W7253 Chloride intracellular ch no no 0.911 0.735 0.270 1e-14
>sp|Q9FRL8|DHAR2_ARATH Glutathione S-transferase DHAR2 OS=Arabidopsis thaliana GN=DHAR2 PE=1 SV=1 Back     alignment and function desciption
 Score =  308 bits (789), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 145/194 (74%), Positives = 167/194 (86%)

Query: 1   MAVEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKV 60
           MA++ICVK AVGAPD+LGDCPFSQR LLTLEEKK+PYK HLIN+SDKPQWF++ISPEGKV
Sbjct: 1   MALDICVKVAVGAPDVLGDCPFSQRVLLTLEEKKLPYKTHLINVSDKPQWFLDISPEGKV 60

Query: 61  PVVKFDDKWVADSDVIVRIIEEKYPEPSLTNPPEFASLGSKIFPSFVNFLKSKDPNDGTE 120
           PVVK D KWVADSDVIV ++EEKYPEPSL  PPEFAS+GSKIF +FV FLKSKD NDG+E
Sbjct: 61  PVVKLDGKWVADSDVIVGLLEEKYPEPSLKTPPEFASVGSKIFGAFVTFLKSKDANDGSE 120

Query: 121 QALLEELKALDEHLKTHGGPFIAGEKVTAVDLSLAPKLYHLQVALEHFKQWTVPESLAHV 180
           +AL++EL+AL+ HLKTH GPF+AGEK+TAVDLSLAPKLYHL+VAL H+K W+VPESL  V
Sbjct: 121 KALVDELEALENHLKTHSGPFVAGEKITAVDLSLAPKLYHLEVALGHYKNWSVPESLTSV 180

Query: 181 HGYTKDGCRRSMHE 194
             Y K    R   E
Sbjct: 181 RNYAKALFSRESFE 194




Exhibits glutathione-dependent thiol transferase and dehydroascorbate (DHA) reductase activities. Key component of the ascorbate recycling system. Involved in the redox homeostasis, especially in scavenging of ROS under oxidative stresses. Plays a role in ozone tolerance.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 8
>sp|Q9FWR4|DHAR1_ARATH Glutathione S-transferase DHAR1, mitochondrial OS=Arabidopsis thaliana GN=DHAR1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FG59|DHAR4_ARATH Putative glutathione S-transferase DHAR4 OS=Arabidopsis thaliana GN=DHAR4 PE=5 SV=1 Back     alignment and function description
>sp|Q8LE52|DHAR3_ARATH Glutathione S-transferase DHAR3, chloroplastic OS=Arabidopsis thaliana GN=DHAR3 PE=1 SV=1 Back     alignment and function description
>sp|O00299|CLIC1_HUMAN Chloride intracellular channel protein 1 OS=Homo sapiens GN=CLIC1 PE=1 SV=4 Back     alignment and function description
>sp|Q9Z1Q5|CLIC1_MOUSE Chloride intracellular channel protein 1 OS=Mus musculus GN=Clic1 PE=1 SV=3 Back     alignment and function description
>sp|Q6MG61|CLIC1_RAT Chloride intracellular channel protein 1 OS=Rattus norvegicus GN=Clic1 PE=1 SV=1 Back     alignment and function description
>sp|Q5E9B7|CLIC1_BOVIN Chloride intracellular channel protein 1 OS=Bos taurus GN=CLIC1 PE=2 SV=3 Back     alignment and function description
>sp|Q95MF9|CLIC1_RABIT Chloride intracellular channel protein 1 OS=Oryctolagus cuniculus GN=CLIC1 PE=2 SV=3 Back     alignment and function description
>sp|Q9Z0W7|CLIC4_RAT Chloride intracellular channel protein 4 OS=Rattus norvegicus GN=Clic4 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
224112877212 predicted protein [Populus trichocarpa] 0.901 0.867 0.837 4e-86
283135906212 DHAR class glutathione transferase DHAR2 0.946 0.910 0.804 1e-85
405779437212 dehydroascorbate reductase, partial [Pop 0.946 0.910 0.798 2e-85
118483826212 unknown [Populus trichocarpa] 0.901 0.867 0.832 5e-85
283135908212 DHAR class glutathione transferase DHAR3 0.901 0.867 0.816 4e-83
255564070211 dehydroascorbate reductase, putative [Ri 0.941 0.909 0.777 5e-83
304367897212 fiber dehydroascorbate reductase protein 0.926 0.891 0.789 5e-83
405779439212 dehydroascorbate reductase, partial [Pop 0.901 0.867 0.816 1e-82
224098218212 predicted protein [Populus trichocarpa] 0.901 0.867 0.816 1e-82
310772392212 dehydroascorbate reductase [Malpighia gl 0.946 0.910 0.768 3e-82
>gi|224112877|ref|XP_002316317.1| predicted protein [Populus trichocarpa] gi|118482397|gb|ABK93121.1| unknown [Populus trichocarpa] gi|118486743|gb|ABK95207.1| unknown [Populus trichocarpa] gi|222865357|gb|EEF02488.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  322 bits (826), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 155/185 (83%), Positives = 169/185 (91%), Gaps = 1/185 (0%)

Query: 1   MAVEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKV 60
           M +EI VKAAVGAPDILGDCPFSQRALLTLEEKK+PYK HLIN+SDKPQWF+E++PEGKV
Sbjct: 1   MVLEIAVKAAVGAPDILGDCPFSQRALLTLEEKKIPYKSHLINLSDKPQWFLEVNPEGKV 60

Query: 61  PVVKFDDKWVADSDVIVRIIEEKYPEPSLTNPPEFASLGSKIFPSFVNFLKSKDPNDGTE 120
           PVVKFDDKWV+DSDVIV I+EEKYPEPSL  PPEFAS+GSKIFPSFV FLKSKDPNDGTE
Sbjct: 61  PVVKFDDKWVSDSDVIVGILEEKYPEPSLATPPEFASVGSKIFPSFVKFLKSKDPNDGTE 120

Query: 121 QALLEELKALDEHLKTHGGPFIAGEKVTAVDLSLAPKLYHLQVALEHFKQWTVPESLAHV 180
           QALLEELKALD+HLK H GPFIAGEK+TAVDLSLAPKLYHL+VAL HFK WT+P+ L HV
Sbjct: 121 QALLEELKALDDHLKAH-GPFIAGEKITAVDLSLAPKLYHLEVALAHFKNWTIPDKLTHV 179

Query: 181 HGYTK 185
             Y K
Sbjct: 180 LNYIK 184




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|283135906|gb|ADB11344.1| DHAR class glutathione transferase DHAR2 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|405779437|gb|AFS18599.1| dehydroascorbate reductase, partial [Populus tomentosa] Back     alignment and taxonomy information
>gi|118483826|gb|ABK93805.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|283135908|gb|ADB11345.1| DHAR class glutathione transferase DHAR3 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255564070|ref|XP_002523033.1| dehydroascorbate reductase, putative [Ricinus communis] gi|223537716|gb|EEF39337.1| dehydroascorbate reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|304367897|gb|ADM26660.1| fiber dehydroascorbate reductase protein [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|405779439|gb|AFS18600.1| dehydroascorbate reductase, partial [Populus tomentosa] Back     alignment and taxonomy information
>gi|224098218|ref|XP_002311137.1| predicted protein [Populus trichocarpa] gi|222850957|gb|EEE88504.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|310772392|dbj|BAJ23959.1| dehydroascorbate reductase [Malpighia glabra] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
TAIR|locus:2025162213 DHAR2 "AT1G75270" [Arabidopsis 0.906 0.868 0.772 2.3e-78
TAIR|locus:2013119213 DHAR1 "dehydroascorbate reduct 0.906 0.868 0.762 1.2e-74
TAIR|locus:2149015258 DHAR3 "dehydroascorbate reduct 0.897 0.709 0.619 1.8e-62
UNIPROTKB|O00299241 CLIC1 "Chloride intracellular 0.637 0.539 0.309 6.6e-21
TAIR|locus:2016492153 AT1G19550 [Arabidopsis thalian 0.284 0.379 0.758 1.7e-20
RGD|70952241 Gsto1 "glutathione S-transfera 0.710 0.601 0.320 3.8e-14
ZFIN|ZDB-GENE-040718-365240 gsto1 "glutathione S-transfera 0.754 0.641 0.329 6.2e-14
FB|FBgn0035904241 GstO3 "Glutathione S transfera 0.764 0.647 0.329 7.9e-14
MGI|MGI:1342273240 Gsto1 "glutathione S-transfera 0.745 0.633 0.327 1e-13
ZFIN|ZDB-GENE-030131-3202241 clic1 "chloride intracellular 0.647 0.547 0.319 1e-13
TAIR|locus:2025162 DHAR2 "AT1G75270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 788 (282.4 bits), Expect = 2.3e-78, P = 2.3e-78
 Identities = 143/185 (77%), Positives = 165/185 (89%)

Query:     1 MAVEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKV 60
             MA++ICVK AVGAPD+LGDCPFSQR LLTLEEKK+PYK HLIN+SDKPQWF++ISPEGKV
Sbjct:     1 MALDICVKVAVGAPDVLGDCPFSQRVLLTLEEKKLPYKTHLINVSDKPQWFLDISPEGKV 60

Query:    61 PVVKFDDKWVADSDVIVRIIEEKYPEPSLTNPPEFASLGSKIFPSFVNFLKSKDPNDGTE 120
             PVVK D KWVADSDVIV ++EEKYPEPSL  PPEFAS+GSKIF +FV FLKSKD NDG+E
Sbjct:    61 PVVKLDGKWVADSDVIVGLLEEKYPEPSLKTPPEFASVGSKIFGAFVTFLKSKDANDGSE 120

Query:   121 QALLEELKALDEHLKTHGGPFIAGEKVTAVDLSLAPKLYHLQVALEHFKQWTVPESLAHV 180
             +AL++EL+AL+ HLKTH GPF+AGEK+TAVDLSLAPKLYHL+VAL H+K W+VPESL  V
Sbjct:   121 KALVDELEALENHLKTHSGPFVAGEKITAVDLSLAPKLYHLEVALGHYKNWSVPESLTSV 180

Query:   181 HGYTK 185
               Y K
Sbjct:   181 RNYAK 185




GO:0045174 "glutathione dehydrogenase (ascorbate) activity" evidence=ISS;IDA
GO:0010731 "protein glutathionylation" evidence=IDA
GO:0043295 "glutathione binding" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0010583 "response to cyclopentenone" evidence=RCA
TAIR|locus:2013119 DHAR1 "dehydroascorbate reductase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149015 DHAR3 "dehydroascorbate reductase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O00299 CLIC1 "Chloride intracellular channel protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2016492 AT1G19550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|70952 Gsto1 "glutathione S-transferase omega 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-365 gsto1 "glutathione S-transferase omega 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0035904 GstO3 "Glutathione S transferase O3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1342273 Gsto1 "glutathione S-transferase omega 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3202 clic1 "chloride intracellular channel 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FWR4DHAR1_ARATH2, ., 5, ., 1, ., 1, 80.76210.90680.8685nono
Q9FRL8DHAR2_ARATH2, ., 5, ., 1, ., 1, 80.74740.95090.9107yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.5.1.180.991
3rd Layer2.5.10.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
PLN02378213 PLN02378, PLN02378, glutathione S-transferase DHAR 5e-98
PLN02817265 PLN02817, PLN02817, glutathione dehydrogenase (asc 4e-96
cd03201121 cd03201, GST_C_DHAR, C-terminal, alpha helical dom 7e-55
cd03198119 cd03198, GST_C_CLIC, C-terminal, alpha helical dom 6e-25
TIGR00862236 TIGR00862, O-ClC, intracellular chloride channel p 2e-20
COG0625211 COG0625, Gst, Glutathione S-transferase [Posttrans 1e-19
pfam1341775 pfam13417, GST_N_3, Glutathione S-transferase, N-t 7e-19
cd0057071 cd00570, GST_N_family, Glutathione S-transferase ( 1e-15
pfam1340968 pfam13409, GST_N_2, Glutathione S-transferase, N-t 2e-15
cd0305589 cd03055, GST_N_Omega, GST_N family, Class Omega su 1e-11
cd10300139 cd10300, GST_C_CLIC1, C-terminal, alpha helical do 1e-11
TIGR01262210 TIGR01262, maiA, maleylacetoacetate isomerase 3e-11
cd10296141 cd10296, GST_C_CLIC4, C-terminal, alpha helical do 3e-08
cd10301140 cd10301, GST_C_CLIC6, C-terminal, alpha helical do 3e-07
cd10299133 cd10299, GST_C_CLIC3, C-terminal, alpha helical do 5e-07
cd0304676 cd03046, GST_N_GTT1_like, GST_N family, Saccharomy 1e-06
cd0305376 cd03053, GST_N_Phi, GST_N family, Class Phi subfam 2e-06
cd00299100 cd00299, GST_C_family, C-terminal, alpha helical d 3e-06
cd0305973 cd03059, GST_N_SspA, GST_N family, Stringent starv 4e-06
cd0304881 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-lik 4e-06
cd0206672 cd02066, GRX_family, Glutaredoxin (GRX) family; co 1e-05
cd0305472 cd03054, GST_N_Metaxin, GST_N family, Metaxin subf 2e-05
cd10298138 cd10298, GST_C_CLIC2, C-terminal, alpha helical do 2e-05
cd10297141 cd10297, GST_C_CLIC5, C-terminal, alpha helical do 2e-05
cd0305076 cd03050, GST_N_Theta, GST_N family, Class Theta su 2e-05
pfam1341069 pfam13410, GST_C_2, Glutathione S-transferase, C-t 4e-05
pfam0279874 pfam02798, GST_N, Glutathione S-transferase, N-ter 4e-05
pfam0004392 pfam00043, GST_C, Glutathione S-transferase, C-ter 3e-04
cd0306071 cd03060, GST_N_Omega_like, GST_N family, Omega-lik 4e-04
cd0308075 cd03080, GST_N_Metaxin_like, GST_N family, Metaxin 8e-04
cd0305673 cd03056, GST_N_4, GST_N family, unknown subfamily 0.001
pfam0046260 pfam00462, Glutaredoxin, Glutaredoxin 0.002
cd0305874 cd03058, GST_N_Tau, GST_N family, Class Tau subfam 0.003
cd03192104 cd03192, GST_C_Sigma_like, C-terminal, alpha helic 0.003
PRK15113214 PRK15113, PRK15113, glutathione S-transferase; Pro 0.004
PLN02395215 PLN02395, PLN02395, glutathione S-transferase 0.004
cd1028982 cd10289, GST_C_AaRS_like, Glutathione S-transferas 0.004
>gnl|CDD|166019 PLN02378, PLN02378, glutathione S-transferase DHAR1 Back     alignment and domain information
 Score =  283 bits (724), Expect = 5e-98
 Identities = 141/185 (76%), Positives = 159/185 (85%)

Query: 1   MAVEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKV 60
           MA+EICVKAAVGAPD LGDCPFSQRALLTLEEK + YK HLIN+SDKPQWF++ISP+GKV
Sbjct: 1   MALEICVKAAVGAPDHLGDCPFSQRALLTLEEKSLTYKIHLINLSDKPQWFLDISPQGKV 60

Query: 61  PVVKFDDKWVADSDVIVRIIEEKYPEPSLTNPPEFASLGSKIFPSFVNFLKSKDPNDGTE 120
           PV+K DDKWV DSDVIV I+EEKYP+P L  P EFAS+GS IF +F  FLKSKD NDG+E
Sbjct: 61  PVLKIDDKWVTDSDVIVGILEEKYPDPPLKTPAEFASVGSNIFGTFGTFLKSKDSNDGSE 120

Query: 121 QALLEELKALDEHLKTHGGPFIAGEKVTAVDLSLAPKLYHLQVALEHFKQWTVPESLAHV 180
            ALL EL+AL+ HLK+H GPFIAGE+V+AVDLSLAPKLYHLQVAL HFK W+VPES  HV
Sbjct: 121 HALLVELEALENHLKSHDGPFIAGERVSAVDLSLAPKLYHLQVALGHFKSWSVPESFPHV 180

Query: 181 HGYTK 185
           H Y K
Sbjct: 181 HNYMK 185


Length = 213

>gnl|CDD|166458 PLN02817, PLN02817, glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>gnl|CDD|198310 cd03201, GST_C_DHAR, C-terminal, alpha helical domain of Dehydroascorbate Reductase Back     alignment and domain information
>gnl|CDD|198307 cd03198, GST_C_CLIC, C-terminal, alpha helical domain of Chloride Intracellular Channels Back     alignment and domain information
>gnl|CDD|129941 TIGR00862, O-ClC, intracellular chloride channel protein Back     alignment and domain information
>gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|239353 cd03055, GST_N_Omega, GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|198333 cd10300, GST_C_CLIC1, C-terminal, alpha helical domain of Chloride Intracellular Channel 1 Back     alignment and domain information
>gnl|CDD|233333 TIGR01262, maiA, maleylacetoacetate isomerase Back     alignment and domain information
>gnl|CDD|198329 cd10296, GST_C_CLIC4, C-terminal, alpha helical domain of Chloride Intracellular Channel 4 Back     alignment and domain information
>gnl|CDD|198334 cd10301, GST_C_CLIC6, C-terminal, alpha helical domain of Chloride Intracellular Channel 6 Back     alignment and domain information
>gnl|CDD|198332 cd10299, GST_C_CLIC3, C-terminal, alpha helical domain of Chloride Intracellular Channel 3 Back     alignment and domain information
>gnl|CDD|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>gnl|CDD|239351 cd03053, GST_N_Phi, GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family Back     alignment and domain information
>gnl|CDD|239357 cd03059, GST_N_SspA, GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>gnl|CDD|239346 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>gnl|CDD|239017 cd02066, GRX_family, Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>gnl|CDD|239352 cd03054, GST_N_Metaxin, GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>gnl|CDD|198331 cd10298, GST_C_CLIC2, C-terminal, alpha helical domain of Chloride Intracellular Channel 2 Back     alignment and domain information
>gnl|CDD|198330 cd10297, GST_C_CLIC5, C-terminal, alpha helical domain of Chloride Intracellular Channel 5 Back     alignment and domain information
>gnl|CDD|239348 cd03050, GST_N_Theta, GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|217234 pfam02798, GST_N, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|239358 cd03060, GST_N_Omega_like, GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>gnl|CDD|239378 cd03080, GST_N_Metaxin_like, GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>gnl|CDD|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>gnl|CDD|215931 pfam00462, Glutaredoxin, Glutaredoxin Back     alignment and domain information
>gnl|CDD|239356 cd03058, GST_N_Tau, GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|198301 cd03192, GST_C_Sigma_like, C-terminal, alpha helical domain of Class Sigma-like Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|185068 PRK15113, PRK15113, glutathione S-transferase; Provisional Back     alignment and domain information
>gnl|CDD|166036 PLN02395, PLN02395, glutathione S-transferase Back     alignment and domain information
>gnl|CDD|198322 cd10289, GST_C_AaRS_like, Glutathione S-transferase C-terminal-like, alpha helical domain of various Aminoacyl-tRNA synthetases and similar domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 204
PLN02378213 glutathione S-transferase DHAR1 100.0
PLN02817265 glutathione dehydrogenase (ascorbate) 100.0
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 100.0
PRK09481211 sspA stringent starvation protein A; Provisional 100.0
KOG1422221 consensus Intracellular Cl- channel CLIC, contains 100.0
KOG0406231 consensus Glutathione S-transferase [Posttranslati 100.0
PLN02473214 glutathione S-transferase 100.0
PRK15113214 glutathione S-transferase; Provisional 100.0
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 99.98
PLN02395215 glutathione S-transferase 99.98
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 99.97
PRK10542201 glutathionine S-transferase; Provisional 99.97
PTZ00057205 glutathione s-transferase; Provisional 99.97
COG0625211 Gst Glutathione S-transferase [Posttranslational m 99.97
KOG0868217 consensus Glutathione S-transferase [Posttranslati 99.97
PRK10357202 putative glutathione S-transferase; Provisional 99.96
PRK11752264 putative S-transferase; Provisional 99.96
PRK10387210 glutaredoxin 2; Provisional 99.95
KOG0867226 consensus Glutathione S-transferase [Posttranslati 99.95
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 99.94
KOG1695206 consensus Glutathione S-transferase [Posttranslati 99.93
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 99.92
KOG4420325 consensus Uncharacterized conserved protein (Gangl 99.92
PLN02907 722 glutamate-tRNA ligase 99.87
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 99.81
KOG4244281 consensus Failed axon connections (fax) protein/gl 99.77
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 99.76
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 99.75
KOG3029370 consensus Glutathione S-transferase-related protei 99.74
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 99.74
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 99.74
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 99.74
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 99.73
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 99.73
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 99.73
cd03198134 GST_C_CLIC GST_C family, Chloride Intracellular Ch 99.72
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 99.72
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 99.72
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 99.71
COG0435324 ECM4 Predicted glutathione S-transferase [Posttran 99.71
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 99.7
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 99.7
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 99.7
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 99.69
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 99.67
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 99.67
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 99.67
cd03201121 GST_C_DHAR GST_C family, Dehydroascorbate Reductas 99.67
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 99.66
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 99.66
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 99.65
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 99.65
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 99.64
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 99.64
KOG2903319 consensus Predicted glutathione S-transferase [Pos 99.64
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 99.64
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 99.63
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 99.62
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 99.62
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 99.6
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 99.59
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 99.55
cd03184124 GST_C_Omega GST_C family, Class Omega subfamily; G 99.54
COG2999215 GrxB Glutaredoxin 2 [Posttranslational modificatio 99.53
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 99.5
cd03196115 GST_C_5 GST_C family, unknown subfamily 5; compose 99.48
KOG3027257 consensus Mitochondrial outer membrane protein Met 99.48
cd03190142 GST_C_ECM4_like GST_C family, ECM4-like subfamily; 99.47
cd03203120 GST_C_Lambda GST_C family, Class Lambda subfamily; 99.45
cd03210126 GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar 99.44
cd03208137 GST_C_Alpha GST_C family, Class Alpha subfamily; G 99.42
cd03186107 GST_C_SspA GST_N family, Stringent starvation prot 99.42
PF0004395 GST_C: Glutathione S-transferase, C-terminal domai 99.39
cd03188114 GST_C_Beta GST_C family, Class Beta subfamily; GST 99.38
cd03207103 GST_C_8 GST_C family, unknown subfamily 8; compose 99.38
cd03209121 GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar 99.38
cd03191121 GST_C_Zeta GST_C family, Class Zeta subfamily; GST 99.37
cd03185126 GST_C_Tau GST_C family, Class Tau subfamily; GSTs 99.37
PF1341069 GST_C_2: Glutathione S-transferase, C-terminal dom 99.35
cd03187118 GST_C_Phi GST_C family, Class Phi subfamily; compo 99.34
cd03204111 GST_C_GDAP1 GST_C family, Ganglioside-induced diff 99.33
PF1449799 GST_C_3: Glutathione S-transferase, C-terminal dom 99.32
cd03183126 GST_C_Theta GST_C family, Class Theta subfamily; c 99.31
cd03177118 GST_C_Delta_Epsilon GST_C family, Class Delta and 99.31
cd03178113 GST_C_Ure2p_like GST_C family, Ure2p-like subfamil 99.31
cd03195114 GST_C_4 GST_C family, unknown subfamily 4; compose 99.3
cd03194114 GST_C_3 GST_C family, unknown subfamily 3; compose 99.29
cd03182117 GST_C_GTT2_like GST_C family, Saccharomyces cerevi 99.27
cd03181123 GST_C_EFB1gamma GST_C family, Gamma subunit of Elo 99.27
cd03180110 GST_C_2 GST_C family, unknown subfamily 2; compose 99.26
cd0320096 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed 99.26
cd03206100 GST_C_7 GST_C family, unknown subfamily 7; compose 99.24
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 99.22
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamil 99.22
cd03189119 GST_C_GTT1_like GST_C family, Saccharomyces cerevi 99.19
cd03202124 GST_C_etherase_LigE GST_C family, Beta etherase Li 99.17
cd0319388 GST_C_Metaxin GST_C family, Metaxin subfamily; com 99.07
PRK1063883 glutaredoxin 3; Provisional 99.05
cd00299100 GST_C_family Glutathione S-transferase (GST) famil 99.02
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 99.01
cd03192104 GST_C_Sigma_like GST_C family, Class Sigma_like; c 98.98
cd03211126 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me 98.96
PF14834117 GST_C_4: Glutathione S-transferase, C-terminal dom 98.94
KOG3028313 consensus Translocase of outer mitochondrial membr 98.93
cd03179105 GST_C_1 GST_C family, unknown subfamily 1; compose 98.93
PRK1032981 glutaredoxin-like protein; Provisional 98.91
cd03197149 GST_C_mPGES2 GST_C family; microsomal Prostaglandi 98.81
cd03212137 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, 98.78
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 98.77
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 98.69
cd0320598 GST_C_6 GST_C family, unknown subfamily 6; compose 98.68
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 98.65
PRK1120085 grxA glutaredoxin 1; Provisional 98.61
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 98.57
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 98.55
PF1056872 Tom37: Outer mitochondrial membrane transport comp 98.48
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 98.47
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 98.47
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 98.36
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 98.32
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 98.3
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 98.26
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 98.22
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 98.21
PHA03050108 glutaredoxin; Provisional 98.21
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 98.16
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 98.09
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 98.07
cd03199128 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub 97.77
PRK10824115 glutaredoxin-4; Provisional 97.75
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 97.55
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 97.53
PF04399132 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain 97.4
KOG1752104 consensus Glutaredoxin and related proteins [Postt 97.38
PTZ00062204 glutaredoxin; Provisional 97.19
KOG1147 712 consensus Glutamyl-tRNA synthetase [Translation, r 96.86
PRK01655131 spxA transcriptional regulator Spx; Reviewed 96.41
COG0278105 Glutaredoxin-related protein [Posttranslational mo 96.36
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 96.17
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 95.94
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 95.9
cd0303092 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 95.82
PRK12559131 transcriptional regulator Spx; Provisional 95.77
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 95.71
PRK13344132 spxA transcriptional regulator Spx; Reviewed 95.7
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 95.36
PF11287112 DUF3088: Protein of unknown function (DUF3088); In 95.14
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 94.56
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 94.32
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 93.68
PF0490899 SH3BGR: SH3-binding, glutamic acid-rich protein; I 93.52
COG1393117 ArsC Arsenate reductase and related proteins, glut 93.46
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 93.34
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p 92.95
PRK10026141 arsenate reductase; Provisional 91.46
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 91.28
PF11801168 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019 91.14
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 90.4
TIGR01616126 nitro_assoc nitrogenase-associated protein. This m 89.72
PRK10853118 putative reductase; Provisional 89.14
KOG0911227 consensus Glutaredoxin-related protein [Posttransl 88.42
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 88.01
COG454585 Glutaredoxin-related protein [Posttranslational mo 87.7
PHA0212575 thioredoxin-like protein 87.24
KOG3425128 consensus Uncharacterized conserved protein [Funct 86.49
PF09635122 MetRS-N: MetRS-N binding domain; InterPro: IPR0182 83.63
TIGR00014114 arsC arsenate reductase (glutaredoxin). composed o 82.24
KOG1668 231 consensus Elongation factor 1 beta/delta chain [Tr 80.36
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
Probab=100.00  E-value=4e-42  Score=260.61  Aligned_cols=203  Identities=70%  Similarity=1.130  Sum_probs=173.0

Q ss_pred             CceEEeeeccCCCCCCCCCCchHHHHHHHHHhcCCCceEEeecCCCCchhhhhhCCCCCccEEEeCCeeeechHHHHHHH
Q 028772            1 MAVEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKVPVVKFDDKWVADSDVIVRII   80 (204)
Q Consensus         1 m~~~l~~~~~~~~~~~~~~sp~~~~v~~~L~~~gi~~~~~~v~~~~~~~~~~~~~p~g~vP~L~~~~~~l~es~aI~~yL   80 (204)
                      |.+|||+|+|-++..+++.||||+||+++|+++|++|+.+.+++.+++++|++.||.|+||+|+++|.+|+||.+|++||
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~p~~~rv~~~L~e~gl~~e~~~v~~~~~~~~~l~inP~G~VPvL~~~~~~l~ES~aI~~YL   80 (213)
T PLN02378          1 MALEICVKAAVGAPDHLGDCPFSQRALLTLEEKSLTYKIHLINLSDKPQWFLDISPQGKVPVLKIDDKWVTDSDVIVGIL   80 (213)
T ss_pred             CceehhhhccCCCCCCCCCCcchHHHHHHHHHcCCCCeEEEeCcccCCHHHHHhCCCCCCCEEEECCEEecCHHHHHHHH
Confidence            89999999999999999999999999999999999999999999888889999999999999999999999999999999


Q ss_pred             HHhCCCCCCCCChHHhhhhcchHHHHHHhhcCCCCCchHHHHHHHHHHHHHHHHhhcCCCcccCCCCChhHHHHHhHHHH
Q 028772           81 EEKYPEPSLTNPPEFASLGSKIFPSFVNFLKSKDPNDGTEQALLEELKALDEHLKTHGGPFIAGEKVTAVDLSLAPKLYH  160 (204)
Q Consensus        81 ~~~~~~~~l~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~~yl~G~~~T~aD~~~~~~l~~  160 (204)
                      +++++...+.++.+++++...++..+..++......+...+.+.+.|..+|++|+.++++|++||++|+||+++++++.+
T Consensus        81 ~~~~~~~~l~~~~~~a~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~~fl~Gd~~T~ADi~l~~~~~~  160 (213)
T PLN02378         81 EEKYPDPPLKTPAEFASVGSNIFGTFGTFLKSKDSNDGSEHALLVELEALENHLKSHDGPFIAGERVSAVDLSLAPKLYH  160 (213)
T ss_pred             HHhCCCCCCCCHHHHHHHHHHHHHHHHHHHhcCChhhHHHHHHHHHHHHHHHHHhcCCCCCcCCCCCchhhHHHHHHHHH
Confidence            99998766666667777777777666555544333445567788899999999986557999999999999999999988


Q ss_pred             HHHHHhcccCCCCCccchHHHHHHHHhhcCcchHhhHhhhhcc
Q 028772          161 LQVALEHFKQWTVPESLAHVHGYTKDGCRRSMHELVLSYAVFE  203 (204)
Q Consensus       161 ~~~~~~~~~~~~~~~~~p~l~~~~~~~~~~p~~~~~l~~~~~~  203 (204)
                      +.........+++.+++|+|++|++++.++|++++++.....+
T Consensus       161 l~~~~~~~~~~~~~~~~p~l~~w~~~~~~rpa~~~~~~~~~~~  203 (213)
T PLN02378        161 LQVALGHFKSWSVPESFPHVHNYMKTLFSLDSFEKTKTEEKYV  203 (213)
T ss_pred             HHHHHHHhcCCCchhHhHHHHHHHHHHhcCCCeecccCChHHH
Confidence            7644333334444478999999999999999999998776554



>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown] Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms] Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>KOG2903 consensus Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>KOG3027 consensus Mitochondrial outer membrane protein Metaxin 2, Metaxin 1-binding protein [Cell wall/membrane/envelope biogenesis; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 Back     alignment and domain information
>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs Back     alignment and domain information
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B Back     alignment and domain information
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B Back     alignment and domain information
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene Back     alignment and domain information
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha Back     alignment and domain information
>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A Back     alignment and domain information
>KOG3028 consensus Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>KOG1147 consensus Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PF11287 DUF3088: Protein of unknown function (DUF3088); InterPro: IPR021439 This family of proteins with unknown function appears to be restricted to Proteobacteria Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PF11801 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>TIGR01616 nitro_assoc nitrogenase-associated protein Back     alignment and domain information
>PRK10853 putative reductase; Provisional Back     alignment and domain information
>KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>KOG3425 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09635 MetRS-N: MetRS-N binding domain; InterPro: IPR018285 This entry represents the N-terminal domain of methionyl-tRNA synthetase (MetRS) Back     alignment and domain information
>TIGR00014 arsC arsenate reductase (glutaredoxin) Back     alignment and domain information
>KOG1668 consensus Elongation factor 1 beta/delta chain [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
3uvh_A241 Crystal Structure Analysis Of E81m Mutant Of Human 1e-19
3swl_A236 Crystal Structure Analysis Of H74a Mutant Of Human 1e-19
3qr6_A241 Crystal Structure Analysis Of H185f Mutant Of Human 2e-19
4iqa_A236 Crystal Structure Analysis Of The E228l Mutant Of H 3e-19
1rk4_A243 Crystal Structure Of A Soluble Dimeric Form Of Oxid 4e-19
1k0o_A241 Crystal Structure Of A Soluble Form Of Clic1. An In 4e-19
3p8w_A241 Crystal Structure Analysis Of R29mE81M DOUBLE MUTAN 9e-19
3o3t_A241 Crystal Structure Analysis Of M32a Mutant Of Human 1e-18
3p90_A241 Crystal Structure Analysis Of H207f Mutant Of Human 4e-18
3tgz_A241 Crystal Structure Analysis Of W35fH207W MUTANT OF H 5e-18
2d2z_A261 Crystal Structure Of Soluble Form Of Clic4 Length = 5e-15
2ahe_A267 Crystal Structure Of A Soluble Form Of Clic4. Inter 5e-15
3fy7_A250 Crystal Structure Of Homo Sapiens Clic3 Length = 25 4e-14
2r4v_A247 Structure Of Human Clic2, Crystal Form A Length = 2 5e-14
2per_A267 Crystal Structure Of Human Chloride Intracellular C 6e-14
1eem_A241 Glutathione Transferase From Homo Sapiens Length = 3e-10
3vln_A241 Human Glutathione Transferase O1-1 C32s Mutant In C 4e-09
3lfl_A240 Crystal Structure Of Human Glutathione Transferase 1e-08
3qag_A239 Human Glutathione Transferase O2 With Glutathione - 9e-08
3qav_A243 Crystal Structure Of A Glutathione S-transferase Fr 1e-07
2yv7_A260 Crystal Structure Of The Clic Homolog From Drosophi 2e-07
3rbt_A246 Crystal Structure Of Glutathione S-Transferase Omeg 2e-07
4hoj_A210 Crystal Structure Of Glutathione Transferase Homolo 6e-07
4ags_A 471 Leishmania Tdr1 - A Unique Trimeric Glutathione Tra 1e-06
4g10_A265 Ligg From Sphingobium Sp. Syk-6 Is Related To The G 6e-06
1e6b_A221 Crystal Structure Of A Zeta Class Glutathione S-Tra 9e-05
4j2f_A223 Crystal Structure Of A Glutathione Transferase Fami 1e-04
1fw1_A216 Glutathione Transferase ZetaMALEYLACETOACETATE ISOM 1e-04
3mdk_A217 Structure Of Stringent Starvation Protein A (Sspa) 1e-04
3lyk_A216 Structure Of Stringent Starvation Protein A Homolog 3e-04
3uap_A227 Crystal Structure Of Glutathione Transferase (Targe 3e-04
2vo4_A219 Glutathione Transferase From Glycine Max Length = 2 7e-04
3lyp_A215 Structure Of Stringent Starvation Protein A Homolog 9e-04
>pdb|3UVH|A Chain A, Crystal Structure Analysis Of E81m Mutant Of Human Clic1 Length = 241 Back     alignment and structure

Iteration: 1

Score = 92.8 bits (229), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 60/211 (28%), Positives = 104/211 (49%), Gaps = 25/211 (11%) Query: 3 VEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKVPV 62 VE+ VKA I G+CPFSQR + L K V + ++ + + ++ P G++P Sbjct: 8 VELFVKAGSDGAKI-GNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPF 66 Query: 63 VKFDDKWVADSDVIVRIIEE-----KYPEPSLTNPPEFASLGSKIFPSFVNFLKSKDP-- 115 + + + D++ I+ +E +YP+ + NP E + G IF F ++K+ +P Sbjct: 67 LLYGTEVHTDTNKIMEFLEAVLCPPRYPKLAALNP-ESNTAGLDIFAKFSAYIKNSNPAL 125 Query: 116 NDGTEQALLEELKALDEHLKT----------------HGGPFIAGEKVTAVDLSLAPKLY 159 ND E+ LL+ LK LD +L + F+ G ++T D +L PKL+ Sbjct: 126 NDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLH 185 Query: 160 HLQVALEHFKQWTVPESLAHVHGYTKDGCRR 190 +QV + ++ +T+PE+ VH Y + R Sbjct: 186 IVQVVCKKYRGFTIPEAFRGVHRYLSNAYAR 216
>pdb|3SWL|A Chain A, Crystal Structure Analysis Of H74a Mutant Of Human Clic1 Length = 236 Back     alignment and structure
>pdb|3QR6|A Chain A, Crystal Structure Analysis Of H185f Mutant Of Human Clic1 Length = 241 Back     alignment and structure
>pdb|4IQA|A Chain A, Crystal Structure Analysis Of The E228l Mutant Of Human Clic1 Length = 236 Back     alignment and structure
>pdb|1RK4|A Chain A, Crystal Structure Of A Soluble Dimeric Form Of Oxidised Clic1 Length = 243 Back     alignment and structure
>pdb|1K0O|A Chain A, Crystal Structure Of A Soluble Form Of Clic1. An Intracellular Chloride Ion Channel Length = 241 Back     alignment and structure
>pdb|3P8W|A Chain A, Crystal Structure Analysis Of R29mE81M DOUBLE MUTANT OF HUMAN CLIC1 Length = 241 Back     alignment and structure
>pdb|3P90|A Chain A, Crystal Structure Analysis Of H207f Mutant Of Human Clic1 Length = 241 Back     alignment and structure
>pdb|3TGZ|A Chain A, Crystal Structure Analysis Of W35fH207W MUTANT OF HUMAN CLIC1 Length = 241 Back     alignment and structure
>pdb|2D2Z|A Chain A, Crystal Structure Of Soluble Form Of Clic4 Length = 261 Back     alignment and structure
>pdb|2AHE|A Chain A, Crystal Structure Of A Soluble Form Of Clic4. Intercellular Chloride Ion Channel Length = 267 Back     alignment and structure
>pdb|3FY7|A Chain A, Crystal Structure Of Homo Sapiens Clic3 Length = 250 Back     alignment and structure
>pdb|2R4V|A Chain A, Structure Of Human Clic2, Crystal Form A Length = 247 Back     alignment and structure
>pdb|2PER|A Chain A, Crystal Structure Of Human Chloride Intracellular Channel Protein 2 Length = 267 Back     alignment and structure
>pdb|1EEM|A Chain A, Glutathione Transferase From Homo Sapiens Length = 241 Back     alignment and structure
>pdb|3VLN|A Chain A, Human Glutathione Transferase O1-1 C32s Mutant In Complex With Ascorbic Acid Length = 241 Back     alignment and structure
>pdb|3LFL|A Chain A, Crystal Structure Of Human Glutathione Transferase Omega 1, Delta 155 Length = 240 Back     alignment and structure
>pdb|3QAG|A Chain A, Human Glutathione Transferase O2 With Glutathione -New Crystal Form Length = 239 Back     alignment and structure
>pdb|3QAV|A Chain A, Crystal Structure Of A Glutathione S-transferase From Antarctic Clam Laternula Elliptica Length = 243 Back     alignment and structure
>pdb|2YV7|A Chain A, Crystal Structure Of The Clic Homolog From Drosophila Melanogaster Length = 260 Back     alignment and structure
>pdb|3RBT|A Chain A, Crystal Structure Of Glutathione S-Transferase Omega 3 From The Silkworm Bombyx Mori Length = 246 Back     alignment and structure
>pdb|4HOJ|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Neisseria Gonorrhoeae, Target Efi-501841, With Bound Glutathione Length = 210 Back     alignment and structure
>pdb|4AGS|A Chain A, Leishmania Tdr1 - A Unique Trimeric Glutathione Transferase Length = 471 Back     alignment and structure
>pdb|4G10|A Chain A, Ligg From Sphingobium Sp. Syk-6 Is Related To The Glutathione Transferase Omega Class Length = 265 Back     alignment and structure
>pdb|1E6B|A Chain A, Crystal Structure Of A Zeta Class Glutathione S-Transferase From Arabidopsis Thaliana Length = 221 Back     alignment and structure
>pdb|4J2F|A Chain A, Crystal Structure Of A Glutathione Transferase Family Member From Ricinus Communis, Target Efi-501866 Length = 223 Back     alignment and structure
>pdb|1FW1|A Chain A, Glutathione Transferase ZetaMALEYLACETOACETATE ISOMERASE Length = 216 Back     alignment and structure
>pdb|3MDK|A Chain A, Structure Of Stringent Starvation Protein A (Sspa) From Pseudomonas Putida Length = 217 Back     alignment and structure
>pdb|3LYK|A Chain A, Structure Of Stringent Starvation Protein A Homolog From Haemophilus Influenzae Length = 216 Back     alignment and structure
>pdb|3UAP|A Chain A, Crystal Structure Of Glutathione Transferase (Target Efi-501774) From Methylococcus Capsulatus Str. Bath Length = 227 Back     alignment and structure
>pdb|2VO4|A Chain A, Glutathione Transferase From Glycine Max Length = 219 Back     alignment and structure
>pdb|3LYP|A Chain A, Structure Of Stringent Starvation Protein A Homolog From Pseudomonas Fluorescens Length = 215 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 6e-56
2r4v_A247 XAP121, chloride intracellular channel protein 2; 9e-55
2ahe_A267 Chloride intracellular channel protein 4; glutathi 1e-54
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 3e-53
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 4e-53
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 3e-45
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 7e-45
3lyk_A216 Stringent starvation protein A homolog; structural 5e-44
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 4e-42
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 6e-41
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 7e-41
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 4e-39
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 5e-40
3lyp_A215 Stringent starvation protein A; structural genomic 1e-36
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 4e-32
4dej_A231 Glutathione S-transferase related protein; transfe 1e-30
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 3e-30
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 3e-28
3lxz_A229 Glutathione S-transferase family protein; structur 1e-27
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 2e-27
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 3e-26
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 9e-26
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 9e-26
3tou_A226 Glutathione S-transferase protein; GSH binding sit 1e-23
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 2e-23
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 1e-22
3niv_A222 Glutathione S-transferase; structural genomics, PS 3e-22
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 5e-22
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 1e-21
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 2e-21
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 4e-21
3n5o_A235 Glutathione transferase; seattle structural genomi 1e-20
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 2e-20
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 2e-20
1axd_A209 Glutathione S-transferase I; transferase, herbicid 7e-20
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 9e-20
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 4e-19
4g9h_A211 Glutathione S-transferase; GST, enzyme function in 2e-18
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 2e-18
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 6e-18
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 2e-16
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 2e-16
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 7e-16
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 8e-16
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 2e-15
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 4e-15
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 6e-15
1f2e_A201 Glutathione S-transferase; GST complexed with glut 6e-15
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 1e-14
1r5a_A218 Glutathione transferase; glutathione S-transferase 2e-14
3ic8_A 310 Uncharacterized GST-like proteinprotein; glutathio 3e-14
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 4e-14
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 1e-13
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 1e-13
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 9e-13
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 1e-12
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 9e-11
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 9e-11
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 2e-10
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 2e-10
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 3e-10
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 3e-10
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 4e-10
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 8e-10
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 1e-09
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 1e-09
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 1e-09
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 1e-09
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 3e-09
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 3e-09
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 3e-09
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 5e-09
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 7e-09
4exj_A238 Uncharacterized protein; transferase-like protein, 1e-08
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 1e-08
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 2e-08
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 2e-08
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 2e-08
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 2e-08
2fhe_A216 GST, glutathione S-transferase; transferase-substr 2e-08
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 3e-08
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 4e-08
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 7e-08
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 1e-07
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 2e-07
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 5e-07
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 9e-07
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 1e-06
4ecj_A244 Glutathione S-transferase; transferase-like protei 1e-06
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 2e-06
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 2e-06
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 6e-06
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 1e-05
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 6e-05
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 3e-04
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 4e-04
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 Back     alignment and structure
 Score =  176 bits (448), Expect = 6e-56
 Identities = 56/205 (27%), Positives = 96/205 (46%), Gaps = 23/205 (11%)

Query: 3   VEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKVPV 62
           VE+ VKA       +G+CPFSQR  + L  K V +    ++   + +   ++ P G++P 
Sbjct: 8   VELFVKAGSD-GAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGELPF 66

Query: 63  VKFDDKWVADSDVIVRIIEEKYPEPSL----TNPPEFASLGSKIFPSFVNFLKSKDP--N 116
           + +  +   D++ I   +E     P         PE  + G  IF  F  ++K+ +P  N
Sbjct: 67  LLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALN 126

Query: 117 DGTEQALLEELKALDEHLKTH----------------GGPFIAGEKVTAVDLSLAPKLYH 160
           D  E+ LL+ LK LD +L +                    F+ G ++T  D +L PKL+ 
Sbjct: 127 DNLEKGLLKALKVLDNYLTSPLPEGVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHI 186

Query: 161 LQVALEHFKQWTVPESLAHVHGYTK 185
           +QV  + ++ +T+PE+   VH Y  
Sbjct: 187 VQVVCKKYRGFTIPEAFRGVHRYLS 211


>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 Back     alignment and structure
>4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Length = 208 Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Length = 290 Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Length = 229 Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Length = 204 Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Length = 207 Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Length = 221 Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218 Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Length = 222 Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Length = 206 Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Length = 221 Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Length = 225 Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Length = 206 Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Length = 206 Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Length = 238 Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Length = 252 Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Length = 208 Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210 Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198 Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Length = 211 Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Length = 211 Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202 Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Length = 215 Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Length = 249 Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219 Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Length = 244 Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218 Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224 Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Length = 260 Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Length = 211 Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Length = 288 Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Length = 248 Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Length = 81 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 204
d1k0ma1149 a.45.1.1 (A:92-240) Chloride intracellular channel 1e-20
d1k0ma286 c.47.1.5 (A:6-91) Chloride intracellular channel 1 1e-18
d1eema298 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sa 7e-17
d1oyja284 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ 8e-15
d1e6ba280 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress 7e-14
d1fw1a283 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi 1e-13
d1aw9a281 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), 3e-12
d1gwca283 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii 9e-12
d1axda280 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), 2e-11
d1jlva284 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph 2e-11
d1r5aa285 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph 2e-11
d1gnwa284 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress ( 1e-10
d1pmta280 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabili 1e-10
d1n2aa280 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli 3e-10
d1f2ea280 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas pau 4e-10
d1g7oa275 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli 3e-09
d1v2aa283 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph 5e-09
d1ljra279 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sap 5e-09
d1k0da292 c.47.1.5 (A:109-200) Yeast prion protein ure2p, ni 4e-08
d2cvda274 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sap 1e-07
d2a2ra277 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapien 2e-07
d1b48a278 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musc 2e-07
d1m0ua276 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Dr 5e-07
d1nm3a174 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hyb 8e-07
d1k3ya279 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sap 9e-07
d1z9ha2113 c.47.1.5 (A:100-212) Microsomal prostaglandin E sy 2e-06
d1fhea280 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepati 3e-06
d1tw9a277 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides 3e-06
d2c4ja284 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapien 4e-06
d1gula277 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sap 4e-06
d1tu7a277 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulu 6e-06
d1oe8a1123 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke ( 8e-05
d2gsqa275 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastre 8e-05
d1duga280 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma jap 1e-04
d1okta285 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasm 2e-04
d1gula1140 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo s 3e-04
d1oe8a281 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Sc 3e-04
d1h75a_76 c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Esch 0.001
d1egoa_85 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 0.003
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure

class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Chloride intracellular channel 1 (clic1)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 81.7 bits (201), Expect = 1e-20
 Identities = 38/126 (30%), Positives = 63/126 (50%), Gaps = 19/126 (15%)

Query: 83  KYPEPSLTNPPEFASLGSKIFPSFVNFLKSKDP--NDGTEQALLEELKALDEHLKTH--- 137
           +YP+ +  NP E  + G  IF  F  ++K+ +P  ND  E+ LL+ LK LD +L +    
Sbjct: 1   RYPKLAALNP-ESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPE 59

Query: 138 -------------GGPFIAGEKVTAVDLSLAPKLYHLQVALEHFKQWTVPESLAHVHGYT 184
                           F+ G ++T  D +L PKL+ +QV  + ++ +T+PE+   VH Y 
Sbjct: 60  GVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYL 119

Query: 185 KDGCRR 190
            +   R
Sbjct: 120 SNAYAR 125


>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 83 Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 80 Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 80 Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 92 Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Length = 74 Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 113 Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 80 Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 77 Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 77 Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 123 Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 75 Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 80 Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 85 Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 81 Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Length = 85 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 99.87
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.8
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.78
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 99.77
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.77
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.76
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 99.76
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 99.76
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.75
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.75
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 99.74
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 99.73
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.73
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.69
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 99.68
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 99.67
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.63
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 99.63
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.62
d1k0ma1149 Chloride intracellular channel 1 (clic1) {Human (H 99.61
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 99.6
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.59
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.59
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1v2aa1125 Class delta GST {Mosquito (Anopheles dirus b), iso 99.58
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 99.58
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1f2ea1121 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.55
d1n2aa1121 Class beta GST {Escherichia coli [TaxId: 562]} 99.55
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.55
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 99.54
d1eema1139 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.54
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.53
d1e6ba1133 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.53
d1k0da1151 Yeast prion protein ure2p, nitrogen regulation fra 99.52
d1fw1a1125 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.52
d1axda1129 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.51
d1aw9a1135 Class phi GST {Maize (Zea mays), type III [TaxId: 99.51
d1pmta1121 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.51
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.51
d1jlva1123 Class delta GST {Mosquito (Anopheles dirus b), iso 99.5
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.49
d1r5aa1129 Class delta GST {Mosquito (Anopheles dirus b), iso 99.49
d1tw9a1129 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.49
d1jlwa1127 Class delta GST {Mosquito (Anopheles dirus b), iso 99.48
d1b48a1143 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.48
d1nhya1144 GST-like domain of elongation factor 1-gamma {Bake 99.48
d3gtub1140 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1k3ya1142 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.47
d1gnwa1126 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.46
d1gula1140 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.46
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 99.44
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.44
d2cvda1124 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.43
d1m0ua1127 Class sigma GST {Fruit fly (Drosophila melanogaste 99.42
d2c4ja1133 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.41
d2gsqa1127 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.41
d1fhea280 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 99.4
d1duga1140 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.4
d1gwca1138 Class tau GST {Aegilops tauschii, also known as Tr 99.4
d1gsua1133 Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 99.39
d1ljra1165 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.38
d2gsta1133 Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 99.37
d2fhea1136 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 99.37
d1oe8a1123 Class alpha GST {Blood fluke (Schistosoma haematob 99.36
d1okta1126 Pf GST {Malarial parasite (Plasmodium falciparum) 99.36
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 99.36
d2a2ra1132 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1oyja1145 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.27
d1tu7a1131 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.27
d1oe8a281 Class alpha GST {Blood fluke (Schistosoma haematob 99.23
d2hrkb1118 GU4 nucleic-binding protein 1, Arc1p {Baker's yeas 99.2
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 98.64
d1z9ha1161 Microsomal prostaglandin E synthase-2 {Crab-eating 98.61
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 98.56
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 98.45
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 98.29
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 97.8
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 97.79
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 97.39
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 97.34
d1g7oa1140 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 96.89
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 96.89
d1wjka_100 Thioredoxin-like structure containing protein C330 96.81
d2fnoa1149 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 95.94
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 93.72
d1rw1a_114 Hypothetical protein PA3664 (YffB) {Pseudomonas ae 89.68
d1z3ea1114 Regulatory protein Spx {Bacillus subtilis [TaxId: 88.2
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione S-transferase (GST), N-terminal domain
domain: Chloride intracellular channel 1 (clic1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87  E-value=3.1e-22  Score=130.47  Aligned_cols=85  Identities=26%  Similarity=0.481  Sum_probs=80.1

Q ss_pred             CEEEEEECCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHCCCCCCCEEEECCEEEECHHHHHHHHH
Q ss_conf             16784320578998878890579999999842999527960289994135643899985379869926205599999999
Q 028772            2 AVEICVKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFMEISPEGKVPVVKFDDKWVADSDVIVRIIE   81 (204)
Q Consensus         2 ~~~l~~~~~~~~~~~~~~sp~~~~v~~~L~~~gi~~~~~~v~~~~~~~~~~~~~p~~~vP~L~~~~~~i~es~~I~~yL~   81 (204)
                      .++||+|++. +.+.++.||||+||+++|.++||+|+.+.++..+++++++++||.|++|+|++||.+++||.+|++||+
T Consensus         2 ~i~l~~ka~~-dg~~~~~cPf~~rv~~~L~~kgi~~~~~~v~~~~~~~~~~~~nP~~~vPvL~~~~~~i~eS~~I~~YLe   80 (86)
T d1k0ma2           2 QVELFVKAGS-DGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGELPFLLYGTEVHTDTNKIEEFLE   80 (86)
T ss_dssp             CEEEEEEBCT-TSSSBCSCHHHHHHHHHHHHHTCCCEEEEECTTSCCHHHHHHCTTCCSSEEEETTEEEECHHHHHHHHH
T ss_pred             CEEEEEECCC-CCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHH
T ss_conf             5899971379-957288887299999999997999578873312241788987116961599982654556999999999


Q ss_pred             HHCCCC
Q ss_conf             758999
Q 028772           82 EKYPEP   87 (204)
Q Consensus        82 ~~~~~~   87 (204)
                      +.++.+
T Consensus        81 e~~~~P   86 (86)
T d1k0ma2          81 AVLCPP   86 (86)
T ss_dssp             HHSCTT
T ss_pred             HHCCCC
T ss_conf             874999



>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure