Citrus Sinensis ID: 028785

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MAARGLLLASIYLSLLVHECYGVTLFSSLQKTLQVTTTTKRGQVLKAGEDKVTITWGLNQSLAAGTDSAYKTMKLQLCFAPVSQKDRAWRKTEDHLNKDKTCSFKIVEKPYNKSLQTLDWIIESDVPTATYFVRAYALNAERHEVAYGQSTNDQKTTNLFDIQAITGRHASLDIASVCFSVFSIVALFGFFFHEKRKARMSQQK
ccHHHHHHHHHHHHHHHHHccccEEEcccccEEEEEECcccccEEEccccEEEEEEcccccccccccccccEEEEEEEEccccccccccccccccccccccccEEEEcccccccccCEEEEEcccccccEEEEEEEEEcccccEEEEccccccccccccEEEEEEcccccEEEEEEEEEEEEccEEEEEEEEEEHHHHHHHHcc
****GLLLASIYLSLLVHECYGVTLFSSLQKTLQVTTTTKRGQVLKAGEDKVTITWGLNQSLAAGTDSAYKTMKLQLCFAPVSQKDRAWRKTEDHLNKDKTCSFKIVEKPYNKSLQTLDWIIESDVPTATYFVRAYALNAERHEVAYGQSTNDQKTTNLFDIQAITGRHASLDIASVCFSVFSIVALFGFFFHE***A******
xxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAARGLLLASIYLSLLVHECYGVTLFSSLQKTLQVTTTTKRGQVLKAGEDKVTITWGLNQSLAAGTDSAYKTMKLQLCFAPVSQKDRAWRKTEDHLNKDKTCSFKIVEKPYNKSLQTLDWIIESDVPTATYFVRAYALNAERHEVAYGQSTNDQKTTNLFDIQAITGRHASLDIASVCFSVFSIVALFGFFFHEKRKARMSQQK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
High-affinity nitrate transporter 3.1 Acts as a dual component transporter with NTR2.1. Required for high-affinity nitrate transport. Acts as a repressor of lateral root initiation. May be involved in targeting NRT2 proteins to the plasma membrane.probableQ9FGS5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZWS, chain A
Confidence level:probable
Coverage over the Query: 46-166
View the alignment between query and template
View the model in PyMOL