Citrus Sinensis ID: 028804


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MSQVFEGYERQYCELSAGLSRKCTAASALDGELKKQKLSEIKTGLDDADALIRKMDLEARSLQPNVKAMLLSKLREYKTDLNNLKNEVKRVTSGNVNQAARDELLESGMADAMMVSADQRGRLLMSTERLNHSTDRIKESRRTMLETEELGVSILQDLHQQRQSLLHAHNTVCPSSSLIVVYLGGHGWCYKSLIFTCVAPWGG
ccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccc
MSQVFEGYERQYCELSAGLSRKCT******************TGLDDADALIRK*************AMLLSKLREYKTDLNNLKNE*******************************************************TMLETEELGVSILQDLHQQRQSLLHAHNTVCPSSSLIVVYLGGHGWCYKSLIFTCVAPWGG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQVFEGYERQYCELSAGLSRKCTAASALDGELKKQKLSEIKTGLDDADALIRKMDLEARSLQPNVxxxxxxxxxxxxxxxxxxxxxxxxxxxxNVNQAARDELLESGMADAMMVSADQRGRLLMSTERLNHSTDRIKESRRTMLETEELGVSILQDLHQQRQSLLHAHNTVCPSSSLIVVYLGGHGWCYKSLIFTCVAPWGG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vesicle transport v-SNARE 11 May function as a v-SNARE responsible for targeting AtELP-containing vesicles from the trans-Golgi network (TGN) to the prevacuolar compartment (PVC). May be also involved in retrograde traffic to the cis-Golgi.probableQ9SEL6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VCS, chain A
Confidence level:very confident
Coverage over the Query: 1-94
View the alignment between query and template
View the model in PyMOL
Template: 2NPS, chain C
Confidence level:confident
Coverage over the Query: 118-182
View the alignment between query and template
View the model in PyMOL