Citrus Sinensis ID: 028810

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---

MASASAETASSSSEIATAAASPTTERRGIPAAQFVEDVQTFLSQLDLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIPDIEKCLDIVATLQAKKEGGEALTADFEVSEGIFSRARIEDTDSVCLWLGANVMLEYSCDEATVLLQKNLENAKASLEVLIADLQFLRDQVTITQVTVARVYNWDVHQRRIRQAAAAAANES

ccccccccccccHHHHcccccccccccccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccEEEEECccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc

******************************AAQFVEDVQTFLSQLDLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIPDIEKCLDIVATLQAKKEGGEALTADFEVSEGIFSRARIEDTDSVCLWLGANVMLEYSCDEATVLLQKNLENAKASLEVLIADLQFLRDQVTITQVTVARVYNWDVHQRR************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASASAETASSSSEIATAAASPTTERRGIPAAQFVEDVQTFLSQLDLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIPDIEKCLDIVATLQAKKEGGEALTADFEVSEGIFSRARIEDTDSVCLWLGANVMLEYSCDEATVLLQKNxxxxxxxxxxxxxxxxxxxxxVTITQVTVARVYNWDVHQRRIRQAAAAAANES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable prefoldin subunit 3	Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.	confident	P57741
Prefoldin subunit 3	Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.	probable	P48363
Probable prefoldin subunit 3	Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.	probable	O18054

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZDI, chain C
Confidence level:confident
Coverage over the Query: 50-184
View the alignment between query and template
View the model in PyMOL