Citrus Sinensis ID: 028827


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MNYSDLCMQYVASGIDLLEKLINVHVCRFQMAAEPVNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTALHKLANPEGEVATARAAASCNTIMVLSFTSSSSIEEVAASCNAVRFYQLYVFKKRDIAATLVQRAERNGFKALVLTADTPRLGRREADIKNK
ccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHcccHHHHHHccccccHHHHHHHHHHHHccccccccccccccccccEEEccccccccEEEccHHHHHcccccHHHHHHHHHHHccccEEEcccccccHHHHHHccccccEEEEcccccHHHHHHHHHHHHHccccEEEEEEccccccccHHHHccc
****DLCMQYVASGIDLLEKLINVHVCRFQMAAEPVNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTALHKLANPEGEVATARAAASCNTIMVLSFTSSSSIEEVAASCNAVRFYQLYVFKKRDIAATLVQRAERNGFKALVLTADTPRLGRREAD****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNYSDLCMQYVASGIDLLEKLINVHVCRFQMAAEPVNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTALHKLANPEGEVATARAAASCNTIMVLSFTSSSSIEEVAASCNAVRFYQLYVFKKRDIAATLVQRAERNGFKALVLTADTPRLGRREADIKNK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 Photorespiratory enzyme that can exert a strong regulation over photosynthesis, possibly through a feed-back inhibition on Rubisco activase. Not required for oxalate accumulation.probableQ8H3I4
Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 probableQ9LJH5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GOX, chain A
Confidence level:very confident
Coverage over the Query: 34-203
View the alignment between query and template
View the model in PyMOL