Citrus Sinensis ID: 028852


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MDSDFWTSRLAAAKRQYTLQQHHHQSSQIDRLSIDDFEVEDDVRPDFPCPYCYEDFDIASLCSHLEDEHSCESKVTVCPICSVKVARDMLSHITLQHGHLFKLQRRRRLRRVAIPSSQALSLLGRDLREAHLQVLLGEAEEISKSVVTSTEDTSAKSAAPTHMWKTSFDPSLSHEEREKRIRQGAGRASFVQDLLLSTLLID
cccHHHHHHHHHHHHHHHHHHHHcccccHHHccccccccccccccccccccccccccHHHHHccccccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccc
***DFWTSRL********************RLSIDDFEVEDDVRPDFPCPYCYEDFDIASLCSHLEDEHSCESKVTVCPICSVKVARDMLSHITLQHGHLFKLQRRR***************LGRDLREAHLQVLLG***************************************************SFVQDLLLSTLLI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSDFWTSRLAAAKRQYTLQQHHHQSSQIDRLSIDDFEVEDDVRPDFPCPYCYEDFDIASLCSHLEDEHSCESKVTVCPICSVKVARDMLSHITLQHGHLFKLQRRRRLRRVAIPSSQALSLLGRDLREAHLQVLLGEAEEISKSVVTSTEDTSAKSAAPTHMWKTSFDPSLSHEEREKRIRQGAGRASFVQDLLLSTLLID

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein DEHYDRATION-INDUCED 19 probableQ688X9
Protein DEHYDRATION-INDUCED 19 homolog 3 probableQ84J70

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RPC, chain A
Confidence level:probable
Coverage over the Query: 42-98
View the alignment between query and template
View the model in PyMOL