Citrus Sinensis ID: 028869
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 202 | 2.2.26 [Sep-21-2011] | |||||||
| Q9SQ64 | 321 | Non-functional NADPH-depe | N/A | no | 0.905 | 0.570 | 0.657 | 1e-67 | |
| Q9SQ67 | 321 | NADPH-dependent codeinone | N/A | no | 0.930 | 0.585 | 0.640 | 3e-67 | |
| Q9SQ69 | 321 | NADPH-dependent codeinone | N/A | no | 0.940 | 0.591 | 0.638 | 6e-67 | |
| Q9SQ68 | 321 | NADPH-dependent codeinone | N/A | no | 0.930 | 0.585 | 0.634 | 5e-61 | |
| B9VRJ2 | 321 | NADPH-dependent codeinone | N/A | no | 0.930 | 0.585 | 0.629 | 6e-60 | |
| Q9SQ70 | 321 | NADPH-dependent codeinone | N/A | no | 0.930 | 0.585 | 0.624 | 6e-60 | |
| P26690 | 315 | NAD(P)H-dependent 6'-deox | no | no | 0.920 | 0.590 | 0.568 | 2e-58 | |
| Q7G764 | 321 | Probable NAD(P)H-dependen | no | no | 0.915 | 0.576 | 0.532 | 3e-55 | |
| Q7G765 | 322 | Probable NAD(P)H-dependen | no | no | 0.945 | 0.593 | 0.515 | 8e-55 | |
| Q84TF0 | 314 | Aldo-keto reductase famil | no | no | 0.836 | 0.538 | 0.463 | 8e-38 |
| >sp|Q9SQ64|COR2_PAPSO Non-functional NADPH-dependent codeinone reductase 2 OS=Papaver somniferum GN=COR2 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 255 bits (652), Expect = 1e-67, Method: Compositional matrix adjust.
Identities = 121/184 (65%), Positives = 149/184 (80%), Gaps = 1/184 (0%)
Query: 12 IPDVPLKSSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGD 71
+P V L SS R MP+LG+GTA + GSE KLAIL+A+++GYRHFDTA +YQTE LG+
Sbjct: 6 VPVVTL-SSGRGMPILGMGTAENNLQGSERVKLAILKAIEVGYRHFDTAFVYQTEGSLGE 64
Query: 72 AIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSS 131
A+AEAL G+IKSRDELFI SKLWC+DA+ + V+PALQ SL NL+LEY+DLY+IHWPVS
Sbjct: 65 AVAEALQNGLIKSRDELFITSKLWCADAYPDHVLPALQNSLRNLKLEYLDLYLIHWPVSL 124
Query: 132 KPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPA 191
KPG + PI K++ P+D+KSVW AME+CQ LG TK+IGVSNFSCKKL ++ATA IPPA
Sbjct: 125 KPGKFVHPIPKDEIFPIDYKSVWAAMEKCQMLGLTKSIGVSNFSCKKLHYLMATANIPPA 184
Query: 192 ANQV 195
NQV
Sbjct: 185 VNQV 188
|
Papaver somniferum (taxid: 3469) EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: - |
| >sp|Q9SQ67|COR14_PAPSO NADPH-dependent codeinone reductase 1-4 OS=Papaver somniferum GN=COR1.4 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9SQ69|COR12_PAPSO NADPH-dependent codeinone reductase 1-2 OS=Papaver somniferum GN=COR1.2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SQ68|COR13_PAPSO NADPH-dependent codeinone reductase 1-3 OS=Papaver somniferum GN=COR1.3 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|B9VRJ2|COR15_PAPSO NADPH-dependent codeinone reductase 1-5 OS=Papaver somniferum GN=COR1.5 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SQ70|COR11_PAPSO NADPH-dependent codeinone reductase 1-1 OS=Papaver somniferum GN=COR1.1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P26690|6DCS_SOYBN NAD(P)H-dependent 6'-deoxychalcone synthase OS=Glycine max PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q7G764|NADO1_ORYSJ Probable NAD(P)H-dependent oxidoreductase 1 OS=Oryza sativa subsp. japonica GN=Os10g0113000 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q7G765|NADO2_ORYSJ Probable NAD(P)H-dependent oxidoreductase 2 OS=Oryza sativa subsp. japonica GN=Os10g0113100 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q84TF0|AKRCA_ARATH Aldo-keto reductase family 4 member C10 OS=Arabidopsis thaliana GN=AKR4C10 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 202 | ||||||
| 40781598 | 321 | reductase 2 [Hydrangea macrophylla] gi|4 | 0.925 | 0.582 | 0.764 | 9e-82 | |
| 255558364 | 325 | aldo-keto reductase, putative [Ricinus c | 0.935 | 0.581 | 0.735 | 1e-77 | |
| 255558366 | 320 | aldo-keto reductase, putative [Ricinus c | 0.930 | 0.587 | 0.723 | 3e-77 | |
| 224102497 | 305 | predicted protein [Populus trichocarpa] | 0.861 | 0.570 | 0.764 | 7e-76 | |
| 225424498 | 318 | PREDICTED: probable NAD(P)H-dependent ox | 0.935 | 0.594 | 0.654 | 5e-68 | |
| 297737568 | 642 | unnamed protein product [Vitis vinifera] | 0.955 | 0.300 | 0.646 | 6e-68 | |
| 255561785 | 325 | aldo-keto reductase, putative [Ricinus c | 0.910 | 0.566 | 0.670 | 4e-67 | |
| 297737569 | 363 | unnamed protein product [Vitis vinifera] | 0.955 | 0.531 | 0.632 | 2e-66 | |
| 75266185 | 321 | RecName: Full=Non-functional NADPH-depen | 0.905 | 0.570 | 0.657 | 6e-66 | |
| 6478210 | 321 | NADPH-dependent codeinone reductase [Pap | 0.930 | 0.585 | 0.645 | 7e-66 |
| >gi|40781598|gb|AAR89808.1| reductase 2 [Hydrangea macrophylla] gi|40781601|gb|AAR89810.1| reductase 2 [Hydrangea macrophylla] | Back alignment and taxonomy information |
|---|
Score = 308 bits (789), Expect = 9e-82, Method: Compositional matrix adjust.
Identities = 143/187 (76%), Positives = 162/187 (86%)
Query: 9 SISIPDVPLKSSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQP 68
+ +IP+VPL S R+MPVLGLGTAA P ET + A+ EA+KLGYRHFDTA LY +EQP
Sbjct: 2 AFTIPEVPLSSGGRKMPVLGLGTAADPPVDPETVRKAVTEALKLGYRHFDTAALYNSEQP 61
Query: 69 LGDAIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWP 128
LGDAIAEAL G+IKSRDELFI SKLWCSDAHRE V PALQK+L+NL+LEYID+Y+IHWP
Sbjct: 62 LGDAIAEALGEGLIKSRDELFITSKLWCSDAHRENVEPALQKTLKNLKLEYIDMYLIHWP 121
Query: 129 VSSKPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKI 188
VSSKPG+YE+PIKKEDFL MD+KSVWEAMEECQ LG TKAIGVSNFSCKKL D+LA AK+
Sbjct: 122 VSSKPGNYEYPIKKEDFLQMDYKSVWEAMEECQKLGLTKAIGVSNFSCKKLSDVLANAKV 181
Query: 189 PPAANQV 195
PPA NQV
Sbjct: 182 PPAVNQV 188
|
Source: Hydrangea macrophylla Species: Hydrangea macrophylla Genus: Hydrangea Family: Hydrangeaceae Order: Cornales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255558364|ref|XP_002520209.1| aldo-keto reductase, putative [Ricinus communis] gi|223540701|gb|EEF42264.1| aldo-keto reductase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255558366|ref|XP_002520210.1| aldo-keto reductase, putative [Ricinus communis] gi|223540702|gb|EEF42265.1| aldo-keto reductase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224102497|ref|XP_002312700.1| predicted protein [Populus trichocarpa] gi|222852520|gb|EEE90067.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225424498|ref|XP_002285202.1| PREDICTED: probable NAD(P)H-dependent oxidoreductase 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297737568|emb|CBI26769.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255561785|ref|XP_002521902.1| aldo-keto reductase, putative [Ricinus communis] gi|223538940|gb|EEF40538.1| aldo-keto reductase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297737569|emb|CBI26770.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|75266185|sp|Q9SQ64.1|COR2_PAPSO RecName: Full=Non-functional NADPH-dependent codeinone reductase 2 gi|6478216|gb|AAF13742.1|AF108438_1 putative NADPH-dependent oxidoreductase [Papaver somniferum] | Back alignment and taxonomy information |
|---|
| >gi|6478210|gb|AAF13739.1|AF108435_1 NADPH-dependent codeinone reductase [Papaver somniferum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 202 | ||||||
| TAIR|locus:2025926 | 320 | AT1G59950 [Arabidopsis thalian | 0.891 | 0.562 | 0.661 | 2e-63 | |
| UNIPROTKB|Q9SQ64 | 321 | COR2 "Non-functional NADPH-dep | 0.925 | 0.582 | 0.647 | 8.8e-63 | |
| UNIPROTKB|Q9SQ67 | 321 | COR1.4 "NADPH-dependent codein | 0.930 | 0.585 | 0.640 | 7.9e-62 | |
| TAIR|locus:2025936 | 326 | AT1G59960 [Arabidopsis thalian | 0.935 | 0.579 | 0.588 | 1e-61 | |
| UNIPROTKB|Q9SQ69 | 321 | COR1.2 "NADPH-dependent codein | 0.930 | 0.585 | 0.645 | 1.6e-61 | |
| UNIPROTKB|Q9SQ68 | 321 | COR1.3 "NADPH-dependent codein | 0.930 | 0.585 | 0.634 | 2.7e-61 | |
| UNIPROTKB|B9VRJ2 | 321 | COR1.5 "NADPH-dependent codein | 0.930 | 0.585 | 0.629 | 1.9e-60 | |
| UNIPROTKB|Q9SQ70 | 321 | COR1.1 "NADPH-dependent codein | 0.930 | 0.585 | 0.624 | 3.1e-60 | |
| UNIPROTKB|E7C196 | 327 | E7C196 "2-carbomethoxy-3-tropi | 0.905 | 0.559 | 0.513 | 2.3e-48 | |
| TAIR|locus:2154164 | 316 | AT5G62420 [Arabidopsis thalian | 0.876 | 0.560 | 0.440 | 3e-37 |
| TAIR|locus:2025926 AT1G59950 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 647 (232.8 bits), Expect = 2.0e-63, P = 2.0e-63
Identities = 119/180 (66%), Positives = 147/180 (81%)
Query: 16 PLKSSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAE 75
P+ S + MPVL LGTAASP K +LEA+KLGYRHFDT+ YQTE+PLG+A+AE
Sbjct: 7 PIGSVHHLMPVLALGTAASPPPEPIVLKRTVLEAIKLGYRHFDTSPRYQTEEPLGEALAE 66
Query: 76 ALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGS 135
A+S G+I+SR ELF+ SKLWC+DAH LVVPA+Q+SLE L+L+Y+DLY+IHWPVSSKPG
Sbjct: 67 AVSLGLIQSRSELFVTSKLWCADAHGGLVVPAIQRSLETLKLDYLDLYLIHWPVSSKPGK 126
Query: 136 YEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPAANQV 195
Y+FPI+++DFLPMD+++VW MEECQ LG K IGVSNFSCKKL IL+ AKIPP+ NQV
Sbjct: 127 YKFPIEEDDFLPMDYETVWSEMEECQRLGVAKCIGVSNFSCKKLQHILSIAKIPPSVNQV 186
|
|
| UNIPROTKB|Q9SQ64 COR2 "Non-functional NADPH-dependent codeinone reductase 2" [Papaver somniferum (taxid:3469)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9SQ67 COR1.4 "NADPH-dependent codeinone reductase 1-4" [Papaver somniferum (taxid:3469)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025936 AT1G59960 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9SQ69 COR1.2 "NADPH-dependent codeinone reductase 1-2" [Papaver somniferum (taxid:3469)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9SQ68 COR1.3 "NADPH-dependent codeinone reductase 1-3" [Papaver somniferum (taxid:3469)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B9VRJ2 COR1.5 "NADPH-dependent codeinone reductase 1-5" [Papaver somniferum (taxid:3469)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9SQ70 COR1.1 "NADPH-dependent codeinone reductase 1-1" [Papaver somniferum (taxid:3469)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7C196 E7C196 "2-carbomethoxy-3-tropinone reductase" [Erythroxylum coca (taxid:289672)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2154164 AT5G62420 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | fgenesh4_pg.C_LG_VIII001733 | hypothetical protein (305 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 202 | |||
| COG0656 | 280 | COG0656, ARA1, Aldo/keto reductases, related to di | 2e-57 | |
| cd06660 | 285 | cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) | 7e-49 | |
| PRK11565 | 275 | PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A | 4e-36 | |
| pfam00248 | 277 | pfam00248, Aldo_ket_red, Aldo/keto reductase famil | 4e-35 | |
| PRK11172 | 267 | PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B | 6e-29 | |
| COG0667 | 316 | COG0667, Tas, Predicted oxidoreductases (related t | 2e-22 | |
| COG1453 | 391 | COG1453, COG1453, Predicted oxidoreductases of the | 3e-12 | |
| PRK10625 | 346 | PRK10625, tas, putative aldo-keto reductase; Provi | 2e-08 | |
| COG4989 | 298 | COG4989, COG4989, Predicted oxidoreductase [Genera | 1e-07 | |
| TIGR01293 | 317 | TIGR01293, Kv_beta, voltage-dependent potassium ch | 1e-06 | |
| PRK09912 | 346 | PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r | 3e-06 | |
| PRK10376 | 290 | PRK10376, PRK10376, putative oxidoreductase; Provi | 6e-04 | |
| PLN02587 | 314 | PLN02587, PLN02587, L-galactose dehydrogenase | 7e-04 |
| >gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
Score = 182 bits (463), Expect = 2e-57
Identities = 68/177 (38%), Positives = 102/177 (57%), Gaps = 21/177 (11%)
Query: 19 SSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALS 78
++ +P +GLGT E A+ A++LGYR DTA +Y E+ +G+AI E+
Sbjct: 9 NNGVEIPAIGLGTW--QIGDDEWAVRAVRAALELGYRLIDTAEIYGNEEEVGEAIKES-- 64
Query: 79 TGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEF 138
G+ R+ELFI +K+W SD + + AL+ SL+ L L+Y+DLY+IHWPV +K E
Sbjct: 65 -GVP--REELFITTKVWPSDLGYDETLKALEASLKRLGLDYVDLYLIHWPVPNKYVVIE- 120
Query: 139 PIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPAANQV 195
W+A+EE + G +AIGVSNF + L ++L+ AK+ PA NQ+
Sbjct: 121 -------------ETWKALEELVDEGLIRAIGVSNFGVEHLEELLSLAKVKPAVNQI 164
|
Length = 280 |
| >gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family | Back alignment and domain information |
|---|
| >gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 202 | |||
| KOG1577 | 300 | consensus Aldo/keto reductase family proteins [Gen | 100.0 | |
| COG0656 | 280 | ARA1 Aldo/keto reductases, related to diketogulona | 100.0 | |
| COG0667 | 316 | Tas Predicted oxidoreductases (related to aryl-alc | 100.0 | |
| KOG1575 | 336 | consensus Voltage-gated shaker-like K+ channel, su | 100.0 | |
| PRK11172 | 267 | dkgB 2,5-diketo-D-gluconate reductase B; Provision | 100.0 | |
| TIGR01293 | 317 | Kv_beta voltage-dependent potassium channel beta s | 100.0 | |
| PRK11565 | 275 | dkgA 2,5-diketo-D-gluconate reductase A; Provision | 100.0 | |
| PRK09912 | 346 | L-glyceraldehyde 3-phosphate reductase; Provisiona | 100.0 | |
| PRK10625 | 346 | tas putative aldo-keto reductase; Provisional | 100.0 | |
| cd06660 | 285 | Aldo_ket_red Aldo-keto reductases (AKRs) are a sup | 100.0 | |
| PLN02587 | 314 | L-galactose dehydrogenase | 100.0 | |
| PRK10376 | 290 | putative oxidoreductase; Provisional | 100.0 | |
| PF00248 | 283 | Aldo_ket_red: Aldo/keto reductase family; InterPro | 100.0 | |
| PRK14863 | 292 | bifunctional regulator KidO; Provisional | 100.0 | |
| COG4989 | 298 | Predicted oxidoreductase [General function predict | 100.0 | |
| KOG1576 | 342 | consensus Predicted oxidoreductase [Energy product | 99.97 | |
| COG1453 | 391 | Predicted oxidoreductases of the aldo/keto reducta | 99.96 | |
| KOG3023 | 285 | consensus Glutamate-cysteine ligase regulatory sub | 98.46 | |
| COG0635 | 416 | HemN Coproporphyrinogen III oxidase and related Fe | 82.35 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 81.73 |
| >KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-48 Score=319.51 Aligned_cols=180 Identities=45% Similarity=0.737 Sum_probs=163.9
Q ss_pred eeecCCCCCccccceeeCCcCCCCChhHHHHHHHHHHHcCCcEEeCCCCCCChHHHHHHHHHHHhCCCCCCCCceEEeec
Q 028869 14 DVPLKSSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALSTGIIKSRDELFIASK 93 (202)
Q Consensus 14 ~~~l~~~~~~v~~lglG~~~~~~~~~~~~~~~l~~A~~~Gi~~~Dta~~Yg~e~~~g~~l~~~~~~~~~~~R~~~~I~tK 93 (202)
+++|++| .+||.||||||+ .++.++.+.++.|++.||||||||..|+||+.+|++|++.+.++.+ +|+++||+||
T Consensus 6 ~~~Ln~G-~~mP~iGlGTw~---~~~~~~~~aV~~Al~~GYRHIDtA~~Y~NE~evG~aik~~i~~~~v-~RediFiTSK 80 (300)
T KOG1577|consen 6 TVKLNNG-FKMPIIGLGTWQ---SPPGQVAEAVKAAIKAGYRHIDTAHVYGNEKEVGEAIKELLAEGGV-KREDIFITSK 80 (300)
T ss_pred eEeccCC-CccceeeeEecc---cChhhHHHHHHHHHHhCcceeechhhhCChHHHHHHHHHHhhhCCc-chhhheeeec
Confidence 7899999 999999999998 6689999999999999999999999999999999999999977766 9999999999
Q ss_pred cCCCCCChhhHHHHHHHHHHHcCCCceeEeeeccCCCCCCCCCCCCCcc--CC-CCCCCHHHHHHHHHHHHHcCCccEEE
Q 028869 94 LWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEFPIKK--ED-FLPMDFKSVWEAMEECQNLGYTKAIG 170 (202)
Q Consensus 94 ~~~~~~~~~~i~~~~~~sL~~Lg~~~vDl~~lh~p~~~~~~~~~~~~~~--~~-~~~~~~~~~~~~l~~l~~~G~ir~iG 170 (202)
+|+..+.++.+..++++||++||+||+|||++|||...++ ..|.+. +. +...+..++|++||++++.|++|+||
T Consensus 81 lw~~~~~~~~v~~al~~sLk~L~ldYvDLyLiH~P~~~k~---~~~~~~~~~~~~~~~~~~~tW~amE~~~~~Gl~rsIG 157 (300)
T KOG1577|consen 81 LWPTDHAPELVEKALEKSLKKLQLDYVDLYLIHWPVAFKD---SFPKDENGKVNYDDVDRIETWKAMEKLVDEGLVRSIG 157 (300)
T ss_pred cCccccChhhHHHHHHHHHHHhChhhhheeeEecccccCC---CCCcccccccccccchHHHHHHHHHHHHHcCCceEee
Confidence 9999999999999999999999999999999999977644 233321 11 33357899999999999999999999
Q ss_pred eCCCCHHHHHHHHHhCCCCCeeeeeecccCc
Q 028869 171 VSNFSCKKLGDILATAKIPPAANQVSFLKKY 201 (202)
Q Consensus 171 vSn~~~~~l~~l~~~~~~~p~~~Q~e~~~~~ 201 (202)
||||+..+++++++.++++|++||+||||.+
T Consensus 158 VSNF~~~~le~ll~~~ki~P~vnQvE~HP~~ 188 (300)
T KOG1577|consen 158 VSNFNIKQLEELLNLAKIKPAVNQVECHPYL 188 (300)
T ss_pred eecCCHHHHHHHHhcCCCCCccceeeccCCc
Confidence 9999999999999999999999999999943
|
|
| >COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
| >TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10625 tas putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >PLN02587 L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >PRK10376 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] | Back alignment and domain information |
|---|
| >PRK14863 bifunctional regulator KidO; Provisional | Back alignment and domain information |
|---|
| >COG4989 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 202 | ||||
| 1zgd_A | 312 | Chalcone Reductase Complexed With Nadp+ At 1.7 Angs | 9e-52 | ||
| 3h7u_A | 335 | Crystal Structure Of The Plant Stress-Response Enzy | 8e-39 | ||
| 3gug_A | 323 | Crystal Structure Of Akr1c1 L308v Mutant In Complex | 3e-36 | ||
| 3c3u_A | 323 | Crystal Structure Of Akr1c1 In Complex With Nadp An | 4e-36 | ||
| 1mrq_A | 323 | Crystal Structure Of Human 20alpha-hsd In Ternary C | 4e-36 | ||
| 2ipg_A | 319 | Crystal Structure Of 17alpha-Hydroxysteroid Dehydro | 7e-36 | ||
| 3fjn_A | 323 | The Crystal Structure Of 17-Alpha Hydroxysteroid De | 8e-36 | ||
| 2he5_A | 323 | Crystal Structure Of 17alpha-Hydroxysteroid Dehydro | 8e-36 | ||
| 2ipf_A | 318 | Crystal Structure Of 17alpha-Hydroxysteroid Dehydro | 9e-36 | ||
| 3cv6_A | 323 | The Crystal Structure Of Mouse 17-Alpha Hydroxyster | 9e-36 | ||
| 3h7r_A | 331 | Crystal Structure Of The Plant Stress-Response Enzy | 1e-35 | ||
| 2ipj_A | 321 | Crystal Structure Of H3alpha-Hydroxysteroid Dehydro | 6e-35 | ||
| 4gac_A | 324 | High Resolution Structure Of Mouse Aldehyde Reducta | 2e-34 | ||
| 1xjb_A | 325 | Crystal Structure Of Human Type 3 3alpha-Hydroxyste | 2e-34 | ||
| 1ihi_A | 323 | Crystal Structure Of Human Type Iii 3-Alpha-Hydroxy | 2e-34 | ||
| 1j96_A | 323 | Human 3alpha-Hsd Type 3 In Ternary Complex With Nad | 2e-34 | ||
| 1cwn_A | 324 | Crystal Structure Of Porcine Aldehyde Reductase Hol | 3e-34 | ||
| 1ae4_A | 325 | Aldehyde Reductase Complexed With Cofactor And Inhi | 4e-34 | ||
| 2bgq_A | 344 | Apo Aldose Reductase From Barley Length = 344 | 4e-34 | ||
| 3cv7_A | 325 | Crystal Structure Of Porcine Aldehyde Reductase Ter | 4e-34 | ||
| 2fvl_A | 324 | Crystal Structure Of Human 3-alpha Hydroxysteroid/d | 6e-34 | ||
| 1ral_A | 308 | Three-Dimensional Structure Of Rat Liver 3alpha- Hy | 6e-34 | ||
| 1lwi_A | 322 | 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FRO | 7e-34 | ||
| 1afs_A | 323 | Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydr | 7e-34 | ||
| 1hqt_A | 326 | The Crystal Structure Of An Aldehyde Reductase Y50f | 1e-33 | ||
| 1q5m_A | 322 | Binary Complex Of Rabbit 20alpha-Hydroxysteroid Deh | 2e-33 | ||
| 1q13_A | 323 | Crystal Structure Of Rabbit 20alpha Hyroxysteroid D | 2e-33 | ||
| 2alr_A | 324 | Aldehyde Reductase Length = 324 | 2e-33 | ||
| 3ln3_A | 324 | Crystal Structure Of Putative Reductase (Np_038806. | 3e-32 | ||
| 3uwe_A | 331 | Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length | 4e-32 | ||
| 1s1p_A | 331 | Crystal Structures Of Prostaglandin D2 11-Ketoreduc | 4e-32 | ||
| 1ry0_A | 323 | Structure Of Prostaglandin F Synthase With Prostagl | 4e-32 | ||
| 3r43_A | 331 | Akr1c3 Complexed With Mefenamic Acid Length = 331 | 4e-32 | ||
| 3uzw_A | 346 | Crystal Structure Of 5beta-Reductase (Akr1d1) E120h | 2e-31 | ||
| 1vp5_A | 298 | Crystal Structure Of 2,5-diketo-d-gluconic Acid Red | 4e-31 | ||
| 3cmf_A | 346 | Crystal Structure Of Human Liver 5beta-Reductase (A | 2e-30 | ||
| 3bur_A | 326 | Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta- | 3e-30 | ||
| 1zua_X | 317 | Crystal Structure Of Akr1b10 Complexed With Nadp+ A | 3e-30 | ||
| 1ah0_A | 316 | Pig Aldose Reductase Complexed With Sorbinil Length | 6e-29 | ||
| 1dla_A | 314 | Novel Nadph-Binding Domain Revealed By The Crystal | 6e-29 | ||
| 1eko_A | 315 | Pig Aldose Reductase Complexed With Idd384 Inhibito | 6e-29 | ||
| 3lz5_A | 316 | Human Aldose Reductase Mutant T113v Complexed With | 6e-28 | ||
| 2pdb_A | 316 | Human Aldose Reductase Mutant F121p Complexed With | 1e-27 | ||
| 2pd5_A | 316 | Human Aldose Reductase Mutant V47i Complexed With Z | 2e-27 | ||
| 3q67_A | 316 | Human Aldose Reductase C298s Mutant In Complex With | 2e-27 | ||
| 2pdx_A | 316 | Human Aldose Reductase Double Mutant S302r-C303d Co | 2e-27 | ||
| 2pdq_A | 316 | Human Aldose Reductase Mutant C303d Complexed With | 2e-27 | ||
| 2ipw_A | 315 | Crystal Structure Of C298a W219y Aldose Reductase C | 2e-27 | ||
| 3rx2_A | 336 | Crystal Structure Of Human Aldose Reductase Complex | 2e-27 | ||
| 2pdm_A | 316 | Human Aldose Reductase Mutant S302r Complexed With | 2e-27 | ||
| 2pdi_A | 316 | Human Aldose Reductase Mutant L300a Complexed With | 2e-27 | ||
| 2pdk_A | 316 | Human Aldose Reductase Mutant L301m Complexed With | 2e-27 | ||
| 1pwl_A | 316 | Crystal Structure Of Human Aldose Reductase Complex | 2e-27 | ||
| 1z3n_A | 319 | Human Aldose Reductase In Complex With Nadp+ And Th | 2e-27 | ||
| 2pdf_A | 316 | Human Aldose Reductase Mutant L300p Complexed With | 2e-27 | ||
| 2agt_A | 319 | Aldose Reductase Mutant Leu 300 Pro Complexed With | 2e-27 | ||
| 1el3_A | 316 | Human Aldose Reductase Complexed With Idd384 Inhibi | 2e-27 | ||
| 3lqg_A | 316 | Human Aldose Reductase Mutant T113a Complexed With | 2e-27 | ||
| 2is7_A | 315 | Crystal Structure Of Aldose Reductase Complexed Wit | 2e-27 | ||
| 1ef3_A | 315 | Fidarestat Bound To Human Aldose Reductase Length = | 2e-27 | ||
| 2r24_A | 316 | Human Aldose Reductase Structure Length = 316 | 2e-27 | ||
| 1xgd_A | 315 | Apo R268a Human Aldose Reductase Length = 315 | 2e-27 | ||
| 3lbo_A | 316 | Human Aldose Reductase Mutant T113c Complexed With | 2e-27 | ||
| 3onb_A | 315 | Bond Breakage And Relocation Of A Covalently Bound | 2e-27 | ||
| 1abn_A | 315 | The Crystal Structure Of The Aldose Reductase Nadph | 2e-27 | ||
| 3ld5_A | 316 | Human Aldose Reductase Mutant T113s Complexed With | 3e-27 | ||
| 2acu_A | 315 | Tyrosine-48 Is The Proton Donor And Histidine-110 D | 8e-27 | ||
| 1vbj_A | 281 | The Crystal Structure Of Prostaglandin F Synthase F | 3e-25 | ||
| 4fzi_A | 290 | Crystal Structure Of Prostaglandin F Synthase From | 7e-25 | ||
| 1z9a_A | 321 | Crystal Structure Of The Asn-309 To Asp Mutant Of C | 1e-24 | ||
| 1ye4_A | 322 | Crystal Structure Of The Lys-274 To Arg Mutant Of C | 1e-24 | ||
| 1jez_A | 322 | The Structure Of Xylose Reductase, A Dimeric Aldo-K | 1e-24 | ||
| 1sm9_A | 322 | Crystal Structure Of An Engineered K274rn276d Doubl | 1e-24 | ||
| 3krb_A | 334 | Structure Of Aldose Reductase From Giardia Lamblia | 1e-24 | ||
| 4f40_A | 288 | X-Ray Crystal Structure Of Apo Prostaglandin F Synt | 4e-24 | ||
| 3o0k_A | 283 | Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL | 5e-24 | ||
| 1r38_A | 322 | Crystal Structure Of H114a Mutant Of Candida Tenuis | 2e-23 | ||
| 1qwk_A | 317 | Structural Genomics Of Caenorhabditis Elegans: Hypo | 3e-23 | ||
| 1c9w_A | 315 | Cho Reductase With Nadp+ Length = 315 | 5e-23 | ||
| 3qkz_A | 316 | Crystal Structure Of Mutant His269arg Akr1b14 Lengt | 1e-22 | ||
| 3o3r_A | 316 | Crystal Structure Of Akr1b14 In Complex With Nadp L | 1e-22 | ||
| 1frb_A | 315 | Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 | 3e-22 | ||
| 3f7j_A | 276 | B.Subtilis Yvgn Length = 276 | 3e-22 | ||
| 3d3f_A | 275 | Crystal Structure Of Yvgn And Cofactor Nadph From B | 3e-22 | ||
| 1mzr_A | 296 | Structure Of Dkga From E.Coli At 2.13 A Resolution | 5e-22 | ||
| 3b3d_A | 314 | B.Subtilis Ytbe Length = 314 | 2e-21 | ||
| 1m9h_A | 278 | Corynebacterium 2,5-dkgr A And Phe 22 Replaced With | 4e-21 | ||
| 1hw6_A | 278 | Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Red | 5e-21 | ||
| 1a80_A | 277 | Native 2,5-Diketo-D-Gluconic Acid Reductase A From | 7e-21 | ||
| 3up8_A | 298 | Crystal Structure Of A Putative 2,5-Diketo-D-Glucon | 1e-19 | ||
| 2wzm_A | 283 | Crystal Structure Of A Mycobacterium Aldo-Keto Redu | 5e-19 | ||
| 1pz1_A | 333 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 3e-11 | ||
| 1pyf_A | 312 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 3e-09 | ||
| 1ynp_A | 317 | Aldo-keto Reductase Akr11c1 From Bacillus Haloduran | 8e-07 | ||
| 1exb_A | 332 | Structure Of The Cytoplasmic Beta Subunit-T1 Assemb | 1e-06 | ||
| 1qrq_A | 325 | Structure Of A Voltage-Dependent K+ Channel Beta Su | 1e-06 | ||
| 2a79_A | 333 | Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu | 1e-06 | ||
| 3lut_A | 367 | A Structural Model For The Full-Length Shaker Potas | 1e-06 | ||
| 3eau_A | 327 | Voltage-Dependent K+ Channel Beta Subunit In Comple | 1e-06 | ||
| 3eb4_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (I211r) I | 1e-06 | ||
| 3n6q_A | 346 | Crystal Structure Of Yghz From E. Coli Length = 346 | 2e-06 | ||
| 4aub_A | 366 | The Complex Structure Of The Bacterial Aldo-Keto Re | 2e-06 | ||
| 1lqa_A | 346 | Tas Protein From Escherichia Coli In Complex With N | 3e-06 | ||
| 1zsx_A | 347 | Crystal Structure Of Human Potassium Channel Kv Bet | 3e-06 | ||
| 3eb3_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (W121a) I | 4e-06 | ||
| 3n2t_A | 348 | Structure Of The Glycerol Dehydrogenase Akr11b4 Fro | 5e-06 | ||
| 3erp_A | 353 | Structure Of Idp01002, A Putative Oxidoreductase Fr | 2e-05 |
| >pdb|1ZGD|A Chain A, Chalcone Reductase Complexed With Nadp+ At 1.7 Angstrom Resolution Length = 312 | Back alignment and structure |
|
| >pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Length = 335 | Back alignment and structure |
| >pdb|3GUG|A Chain A, Crystal Structure Of Akr1c1 L308v Mutant In Complex With Nadp And 3,5-Dichlorosalicylic Acid Length = 323 | Back alignment and structure |
| >pdb|3C3U|A Chain A, Crystal Structure Of Akr1c1 In Complex With Nadp And 3,5- Dichlorosalicylic Acid Length = 323 | Back alignment and structure |
| >pdb|1MRQ|A Chain A, Crystal Structure Of Human 20alpha-hsd In Ternary Complex With Nadp And 20alpha-hydroxy-progesterone Length = 323 | Back alignment and structure |
| >pdb|2IPG|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase Mutant K31a In Complex With Nadp+ And Epi-Testosterone Length = 319 | Back alignment and structure |
| >pdb|3FJN|A Chain A, The Crystal Structure Of 17-Alpha Hydroxysteroid Dehydrogenase Y224d Mutant. Length = 323 | Back alignment and structure |
| >pdb|2HE5|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Binary Complex With Nadp(H) In An Open Conformation Length = 323 | Back alignment and structure |
| >pdb|2IPF|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp+ And Epi-Testosterone Length = 318 | Back alignment and structure |
| >pdb|3CV6|A Chain A, The Crystal Structure Of Mouse 17-Alpha Hydroxysteroid Dehydrogenase Gg225.226pp Mutant In Complex With Inhibitor And Cofactor Nadp+. Length = 323 | Back alignment and structure |
| >pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 | Back alignment and structure |
| >pdb|2IPJ|A Chain A, Crystal Structure Of H3alpha-Hydroxysteroid Dehydrogenase Type 3 Mutant Y24a In Complex With Nadp+ And Epi-Testosterone Length = 321 | Back alignment and structure |
| >pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 | Back alignment and structure |
| >pdb|1XJB|A Chain A, Crystal Structure Of Human Type 3 3alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp(H), Citrate And Acetate Molecules Length = 325 | Back alignment and structure |
| >pdb|1IHI|A Chain A, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate Length = 323 | Back alignment and structure |
| >pdb|1J96|A Chain A, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone Length = 323 | Back alignment and structure |
| >pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 | Back alignment and structure |
| >pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 | Back alignment and structure |
| >pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 | Back alignment and structure |
| >pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 | Back alignment and structure |
| >pdb|2FVL|A Chain A, Crystal Structure Of Human 3-alpha Hydroxysteroid/dihydrodiol Dehydrogenase (akr1c4) Complexed With Nadp+ Length = 324 | Back alignment and structure |
| >pdb|1RAL|A Chain A, Three-Dimensional Structure Of Rat Liver 3alpha- Hydroxysteroid(Slash)dihydrodiol Dehydrogenase: A Member Of The Aldo-Keto Reductase Superfamily Length = 308 | Back alignment and structure |
| >pdb|1LWI|A Chain A, 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FROM Rattus Norvegicus Length = 322 | Back alignment and structure |
| >pdb|1AFS|A Chain A, Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydrogenase (3-Alpha-Hsd) Complexed With Nadp And Testosterone Length = 323 | Back alignment and structure |
| >pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 | Back alignment and structure |
| >pdb|1Q5M|A Chain A, Binary Complex Of Rabbit 20alpha-Hydroxysteroid Dehydrogenase With Nadph Length = 322 | Back alignment and structure |
| >pdb|1Q13|A Chain A, Crystal Structure Of Rabbit 20alpha Hyroxysteroid Dehydrogenase In Ternary Complex With Nadp And Testosterone Length = 323 | Back alignment and structure |
| >pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 | Back alignment and structure |
| >pdb|3LN3|A Chain A, Crystal Structure Of Putative Reductase (Np_038806.2) From Mus Musculus At 1.18 A Resolution Length = 324 | Back alignment and structure |
| >pdb|3UWE|A Chain A, Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length = 331 | Back alignment and structure |
| >pdb|1S1P|A Chain A, Crystal Structures Of Prostaglandin D2 11-Ketoreductase (Akr1c3) In Complex With The Non-Steroidal Anti- Inflammatory Drugs Flufenamic Acid And Indomethacin Length = 331 | Back alignment and structure |
| >pdb|1RY0|A Chain A, Structure Of Prostaglandin F Synthase With Prostaglandin D2 Length = 323 | Back alignment and structure |
| >pdb|3R43|A Chain A, Akr1c3 Complexed With Mefenamic Acid Length = 331 | Back alignment and structure |
| >pdb|3UZW|A Chain A, Crystal Structure Of 5beta-Reductase (Akr1d1) E120h Mutant In Complex With Nadp+ Length = 346 | Back alignment and structure |
| >pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 | Back alignment and structure |
| >pdb|3CMF|A Chain A, Crystal Structure Of Human Liver 5beta-Reductase (Akr1d1) In Complex With Nadp And Cortisone. Resolution 1.90 A. Length = 346 | Back alignment and structure |
| >pdb|3BUR|A Chain A, Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta-Reductase In Complex With Nadp And Testosterone. Resolution: 1.62 A. Length = 326 | Back alignment and structure |
| >pdb|1ZUA|X Chain X, Crystal Structure Of Akr1b10 Complexed With Nadp+ And Tolrestat Length = 317 | Back alignment and structure |
| >pdb|1AH0|A Chain A, Pig Aldose Reductase Complexed With Sorbinil Length = 316 | Back alignment and structure |
| >pdb|1DLA|A Chain A, Novel Nadph-Binding Domain Revealed By The Crystal Structure Of Aldose Reductase Length = 314 | Back alignment and structure |
| >pdb|1EKO|A Chain A, Pig Aldose Reductase Complexed With Idd384 Inhibitor Length = 315 | Back alignment and structure |
| >pdb|3LZ5|A Chain A, Human Aldose Reductase Mutant T113v Complexed With Idd594 Length = 316 | Back alignment and structure |
| >pdb|2PDB|A Chain A, Human Aldose Reductase Mutant F121p Complexed With Zopolrestat. Length = 316 | Back alignment and structure |
| >pdb|2PD5|A Chain A, Human Aldose Reductase Mutant V47i Complexed With Zopolrestat Length = 316 | Back alignment and structure |
| >pdb|3Q67|A Chain A, Human Aldose Reductase C298s Mutant In Complex With Nadp+ In Space Group P212121 Length = 316 | Back alignment and structure |
| >pdb|2PDX|A Chain A, Human Aldose Reductase Double Mutant S302r-C303d Complexed With Zopolrestat. Length = 316 | Back alignment and structure |
| >pdb|2PDQ|A Chain A, Human Aldose Reductase Mutant C303d Complexed With Uracil- Type Inhibitor. Length = 316 | Back alignment and structure |
| >pdb|2IPW|A Chain A, Crystal Structure Of C298a W219y Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 | Back alignment and structure |
| >pdb|3RX2|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Sulindac Sulfone Length = 336 | Back alignment and structure |
| >pdb|2PDM|A Chain A, Human Aldose Reductase Mutant S302r Complexed With Zopolrestat. Length = 316 | Back alignment and structure |
| >pdb|2PDI|A Chain A, Human Aldose Reductase Mutant L300a Complexed With Zopolrestat At 1.55 A. Length = 316 | Back alignment and structure |
| >pdb|2PDK|A Chain A, Human Aldose Reductase Mutant L301m Complexed With Sorbinil. Length = 316 | Back alignment and structure |
| >pdb|1PWL|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Nadp And Minalrestat Length = 316 | Back alignment and structure |
| >pdb|1Z3N|A Chain A, Human Aldose Reductase In Complex With Nadp+ And The Inhibitor Lidorestat At 1.04 Angstrom Length = 319 | Back alignment and structure |
| >pdb|2PDF|A Chain A, Human Aldose Reductase Mutant L300p Complexed With Zopolrestat. Length = 316 | Back alignment and structure |
| >pdb|2AGT|A Chain A, Aldose Reductase Mutant Leu 300 Pro Complexed With Fidarestat Length = 319 | Back alignment and structure |
| >pdb|1EL3|A Chain A, Human Aldose Reductase Complexed With Idd384 Inhibitor Length = 316 | Back alignment and structure |
| >pdb|3LQG|A Chain A, Human Aldose Reductase Mutant T113a Complexed With Idd388 Length = 316 | Back alignment and structure |
| >pdb|2IS7|A Chain A, Crystal Structure Of Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 | Back alignment and structure |
| >pdb|1EF3|A Chain A, Fidarestat Bound To Human Aldose Reductase Length = 315 | Back alignment and structure |
| >pdb|2R24|A Chain A, Human Aldose Reductase Structure Length = 316 | Back alignment and structure |
| >pdb|1XGD|A Chain A, Apo R268a Human Aldose Reductase Length = 315 | Back alignment and structure |
| >pdb|3LBO|A Chain A, Human Aldose Reductase Mutant T113c Complexed With Idd594 Length = 316 | Back alignment and structure |
| >pdb|3ONB|A Chain A, Bond Breakage And Relocation Of A Covalently Bound Bromine Of Idd594 In A Complex With Har T113a Mutant After Extensive Radiation Dose Length = 315 | Back alignment and structure |
| >pdb|1ABN|A Chain A, The Crystal Structure Of The Aldose Reductase Nadph Binary Complex Length = 315 | Back alignment and structure |
| >pdb|3LD5|A Chain A, Human Aldose Reductase Mutant T113s Complexed With Idd594 Length = 316 | Back alignment and structure |
| >pdb|2ACU|A Chain A, Tyrosine-48 Is The Proton Donor And Histidine-110 Directs Substrate Stereochemical Selectivity In The Reduction Reaction Of Human Aldose Reductase: Enzyme Kinetics And The Crystal Structure Of The Y48h Mutant Enzyme Length = 315 | Back alignment and structure |
| >pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 | Back alignment and structure |
| >pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 | Back alignment and structure |
| >pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 | Back alignment and structure |
| >pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 | Back alignment and structure |
| >pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 | Back alignment and structure |
| >pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 | Back alignment and structure |
| >pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 | Back alignment and structure |
| >pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 | Back alignment and structure |
| >pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 | Back alignment and structure |
| >pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 | Back alignment and structure |
| >pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 | Back alignment and structure |
| >pdb|1C9W|A Chain A, Cho Reductase With Nadp+ Length = 315 | Back alignment and structure |
| >pdb|3QKZ|A Chain A, Crystal Structure Of Mutant His269arg Akr1b14 Length = 316 | Back alignment and structure |
| >pdb|3O3R|A Chain A, Crystal Structure Of Akr1b14 In Complex With Nadp Length = 316 | Back alignment and structure |
| >pdb|1FRB|A Chain A, Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 | Back alignment and structure |
| >pdb|3F7J|A Chain A, B.Subtilis Yvgn Length = 276 | Back alignment and structure |
| >pdb|3D3F|A Chain A, Crystal Structure Of Yvgn And Cofactor Nadph From Bacillus Subtilis Length = 275 | Back alignment and structure |
| >pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 | Back alignment and structure |
| >pdb|3B3D|A Chain A, B.Subtilis Ytbe Length = 314 | Back alignment and structure |
| >pdb|1M9H|A Chain A, Corynebacterium 2,5-dkgr A And Phe 22 Replaced With Tyr (f22y), Lys 232 Replaced With Gly (k232g), Arg 238 Replaced With His (r238h)and Ala 272 Replaced With Gly (a272g)in Presence Of Nadh Cofactor Length = 278 | Back alignment and structure |
| >pdb|1HW6|A Chain A, Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Reductase Length = 278 | Back alignment and structure |
| >pdb|1A80|A Chain A, Native 2,5-Diketo-D-Gluconic Acid Reductase A From Corynbacterium Sp. Complexed With Nadph Length = 277 | Back alignment and structure |
| >pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 | Back alignment and structure |
| >pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 | Back alignment and structure |
| >pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 | Back alignment and structure |
| >pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 | Back alignment and structure |
| >pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo Form) Length = 317 | Back alignment and structure |
| >pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 | Back alignment and structure |
| >pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 | Back alignment and structure |
| >pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 | Back alignment and structure |
| >pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 | Back alignment and structure |
| >pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 | Back alignment and structure |
| >pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 | Back alignment and structure |
| >pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 | Back alignment and structure |
| >pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 | Back alignment and structure |
| >pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 | Back alignment and structure |
| >pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 | Back alignment and structure |
|---|
Score = 284 bits (730), Expect = 1e-97
Identities = 104/191 (54%), Positives = 138/191 (72%), Gaps = 4/191 (2%)
Query: 7 MGSISIPDVPLKSSN--RRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQ 64
MGS+ IP L +++ +MPV+G+G+A +T AI+EA+K GYRHFDTA Y
Sbjct: 1 MGSVEIPTKVLTNTSSQLKMPVVGMGSAPDFTCKKDTKD-AIIEAIKQGYRHFDTAAAYG 59
Query: 65 TEQPLGDAIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYV 124
+EQ LG+A+ EA+ G++ RD+LF+ SKLW ++ H LV+PALQKSL+ LQL+Y+DLY+
Sbjct: 60 SEQALGEALKEAIELGLVT-RDDLFVTSKLWVTENHPHLVIPALQKSLKTLQLDYLDLYL 118
Query: 125 IHWPVSSKPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILA 184
IHWP+SS+PG + FPI D LP D K VWE+MEE LG TKAIGVSNFS KKL ++L+
Sbjct: 119 IHWPLSSQPGKFSFPIDVADLLPFDVKGVWESMEESLKLGLTKAIGVSNFSVKKLENLLS 178
Query: 185 TAKIPPAANQV 195
A + PA NQV
Sbjct: 179 VATVLPAVNQV 189
|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 | Back alignment and structure |
|---|
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 | Back alignment and structure |
|---|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 202 | |||
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 100.0 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 100.0 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 100.0 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 100.0 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 100.0 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 100.0 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 100.0 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 100.0 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 100.0 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 100.0 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 100.0 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 100.0 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 100.0 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 100.0 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 100.0 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 100.0 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 100.0 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 100.0 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 100.0 | |
| 4exb_A | 292 | Putative uncharacterized protein; aldo-keto reduct | 100.0 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 100.0 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 100.0 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 100.0 | |
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 100.0 | |
| 3b3d_A | 314 | YTBE protein, putative morphine dehydrogenase; ald | 100.0 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 100.0 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 100.0 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 100.0 | |
| 4gac_A | 324 | Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe | 100.0 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 100.0 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 100.0 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 100.0 | |
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 100.0 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 100.0 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 100.0 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 100.0 | |
| 3cf4_A | 807 | Acetyl-COA decarboxylase/synthase alpha subunit; m | 87.43 |
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-46 Score=316.75 Aligned_cols=190 Identities=38% Similarity=0.695 Sum_probs=166.6
Q ss_pred CCCCeeecCCCCCccccceeeCCcCCCCChhHHHHHHHHHHHcCCcEEeCCCCCCChHHHHHHHHHHHhCCCCCCCCceE
Q 028869 10 ISIPDVPLKSSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALSTGIIKSRDELF 89 (202)
Q Consensus 10 ~~~~~~~l~~~~~~v~~lglG~~~~~~~~~~~~~~~l~~A~~~Gi~~~Dta~~Yg~e~~~g~~l~~~~~~~~~~~R~~~~ 89 (202)
..|++++|++| ++||+||||||+++..+.+++.++++.|++.||||||||+.||+|+.+|++|++.+++|.+ +|+++|
T Consensus 4 ~~m~~~~L~tg-~~v~~lglGt~~~~~~~~~~~~~~v~~Al~~Gi~~~DTA~~Yg~E~~lG~al~~~~~~~~~-~R~~~~ 81 (324)
T 3ln3_A 4 SXQHCVXLNDG-HLIPALGFGTYXPXEVPXSXSLEAACLALDVGYRHVDTAYAYQVEEEIGQAIQSXIXAGVV-XREDLF 81 (324)
T ss_dssp --CCEEECTTS-CEEESSEEECCCCTTSCHHHHHHHHHHHHHHTCCEEECCGGGTCHHHHHHHHHHHHHTTSC-CGGGCE
T ss_pred cCCceEECCCC-CCcCCeeecCCcccCCChHHHHHHHHHHHHcCCCEEECcccccCHHHHHHHHHHhhccCCc-ccceeE
Confidence 45999999655 9999999999998767889999999999999999999999999999999999988777643 899999
Q ss_pred EeeccCCCCCChhhHHHHHHHHHHHcCCCceeEeeeccCCCCCCCCCCCCCccCC---CCCCCHHHHHHHHHHHHHcCCc
Q 028869 90 IASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEFPIKKED---FLPMDFKSVWEAMEECQNLGYT 166 (202)
Q Consensus 90 I~tK~~~~~~~~~~i~~~~~~sL~~Lg~~~vDl~~lh~p~~~~~~~~~~~~~~~~---~~~~~~~~~~~~l~~l~~~G~i 166 (202)
|+||+|....+++.+++++++||++||+||+|+|++|||+...+++..+|.+.+. +.....+++|++|++|+++|||
T Consensus 82 I~TK~~~~~~~~~~v~~~~~~SL~rL~~dyiDl~llH~p~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~al~~l~~~Gki 161 (324)
T 3ln3_A 82 VTTKLWCTCFRPELVXPALEXSLXXLQLDYVDLYIMHYPVPMXSGDNDFPVNEQGXSLLDTVDFCDTWERLEECXDAGLV 161 (324)
T ss_dssp EEEEECGGGCSHHHHHHHHHHHHHHHTCSCEEEEEESCSCCBCCSSCSSCBCTTCCBCBCCCCHHHHHHHHHHHHHTTSE
T ss_pred EEeeeCCccCCHHHHHHHHHHHHHHhCCCcceEEEEecCccccccccccccccccccccccCCHHHHHHHHHHHHhcCCe
Confidence 9999999888999999999999999999999999999998765544333332211 2345689999999999999999
Q ss_pred cEEEeCCCCHHHHHHHHHhCCCC--CeeeeeecccCc
Q 028869 167 KAIGVSNFSCKKLGDILATAKIP--PAANQVSFLKKY 201 (202)
Q Consensus 167 r~iGvSn~~~~~l~~l~~~~~~~--p~~~Q~e~~~~~ 201 (202)
|+||||||++++++++++.++++ |++||++|||.+
T Consensus 162 r~iGvSn~~~~~l~~~~~~~~~~~~p~~~Q~~~~~~~ 198 (324)
T 3ln3_A 162 XSIGVSNFNHRQLERILNXPGLXYXPVCNQVECHLYL 198 (324)
T ss_dssp EEEEEESCCHHHHHHHHTCTTCCCCCSEEEEECBTTB
T ss_pred eEEEecCCcHHHHHHHHHhcCccCCceeeEeeeCccc
Confidence 99999999999999999988876 999999999863
|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} | Back alignment and structure |
|---|
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* | Back alignment and structure |
|---|
| >3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* | Back alignment and structure |
|---|
| >4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* | Back alignment and structure |
|---|
| >3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 202 | ||||
| d1afsa_ | 319 | c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase | 4e-31 | |
| d1us0a_ | 314 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 3e-30 | |
| d1mi3a_ | 319 | c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu | 1e-29 | |
| d1s1pa_ | 315 | c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak | 3e-29 | |
| d1hqta_ | 324 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 3e-26 | |
| d1frba_ | 315 | c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce | 4e-24 | |
| d1vp5a_ | 284 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 2e-22 | |
| d1lqaa_ | 346 | c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: | 6e-22 | |
| d1qwka_ | 312 | c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod | 9e-20 | |
| d1mzra_ | 274 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 3e-19 | |
| d1hw6a_ | 262 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 9e-17 | |
| d3eaua1 | 326 | c.1.7.1 (A:36-361) Voltage-dependent K+ channel be | 3e-14 | |
| d1pyfa_ | 311 | c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu | 4e-13 | |
| d1pz1a_ | 333 | c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu | 5e-11 | |
| d1gvea_ | 324 | c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) | 1e-09 | |
| d1ur3m_ | 298 | c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc | 2e-08 |
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: 3-alpha-hydroxysteroid dehydrogenase species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 113 bits (283), Expect = 4e-31
Identities = 74/187 (39%), Positives = 109/187 (58%), Gaps = 6/187 (3%)
Query: 7 MGSISIPDVPLKSSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTE 66
M SIS V L + +PVLG GT + A A+ G+RHFD+A LY+ E
Sbjct: 1 MDSIS-LRVAL-NDGNFIPVLGFGTTVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYEVE 58
Query: 67 QPLGDAIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIH 126
+ +G AI + G +K R+++F SKLW + ELV L+K+L++ QL+Y+DLY+IH
Sbjct: 59 EEVGQAIRSKIEDGTVK-REDIFYTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIH 117
Query: 127 WPVSSKPGSYEFPI---KKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDIL 183
+P++ +PG FP K F +D WEAME+C++ G K+IGVSNF+C++L IL
Sbjct: 118 FPMALQPGDIFFPRDEHGKLLFETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERIL 177
Query: 184 ATAKIPP 190
+
Sbjct: 178 NKPGLKY 184
|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 | Back information, alignment and structure |
|---|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 | Back information, alignment and structure |
|---|
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 202 | |||
| d1ur3m_ | 298 | Hypothetical oxidoreductase YdhF {Escherichia coli | 100.0 | |
| d1vp5a_ | 284 | 2,5-diketo-D-gluconic acid reductase A {Thermotoga | 100.0 | |
| d1afsa_ | 319 | 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus | 100.0 | |
| d1s1pa_ | 315 | Prostaglandin d2 11-ketoreductase (akr1c3) {Human | 100.0 | |
| d1hw6a_ | 262 | 2,5-diketo-D-gluconic acid reductase A {Corynebact | 100.0 | |
| d1qwka_ | 312 | Hypothetical protein C07D8.6 {Nematode (Caenorhabd | 100.0 | |
| d1mi3a_ | 319 | Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 | 100.0 | |
| d1us0a_ | 314 | Aldose reductase (aldehyde reductase) {Human (Homo | 100.0 | |
| d1mzra_ | 274 | 2,5-diketo-D-gluconic acid reductase A {Escherichi | 100.0 | |
| d1pyfa_ | 311 | Putative oxidoreductase IolS {Bacillus subtilis [T | 100.0 | |
| d1lqaa_ | 346 | Tas protein {Escherichia coli [TaxId: 562]} | 100.0 | |
| d1hqta_ | 324 | Aldose reductase (aldehyde reductase) {Pig (Sus sc | 100.0 | |
| d1frba_ | 315 | FR-1 (fibroblast growth factor-induced) protein {M | 100.0 | |
| d1pz1a_ | 333 | Putative oxidoreductase YhdN {Bacillus subtilis [T | 100.0 | |
| d1gvea_ | 324 | Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus | 100.0 | |
| d3eaua1 | 326 | Voltage-dependent K+ channel beta subunit {Rat (Ra | 100.0 | |
| d2g0wa1 | 275 | Hypothetical protein Lmo2234 {Listeria monocytogen | 86.76 |
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: Hypothetical oxidoreductase YdhF species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=3.2e-41 Score=278.21 Aligned_cols=169 Identities=22% Similarity=0.269 Sum_probs=155.1
Q ss_pred CCeeecCCCCCccccceeeCCcCCC--CChhHHHHHHHHHHHcCCcEEeCCCCCC---ChHHHHHHHHHHHhCCCCCCCC
Q 028869 12 IPDVPLKSSNRRMPVLGLGTAASPF--SGSETTKLAILEAMKLGYRHFDTATLYQ---TEQPLGDAIAEALSTGIIKSRD 86 (202)
Q Consensus 12 ~~~~~l~~~~~~v~~lglG~~~~~~--~~~~~~~~~l~~A~~~Gi~~~Dta~~Yg---~e~~~g~~l~~~~~~~~~~~R~ 86 (202)
|++++||++|.+||+||||||++++ .+++++.++|++|++.|||+||||+.|| +|..+|++|+.. +. +|+
T Consensus 2 m~~~~lg~~G~~vs~ig~G~~~~~~~~~~~~~~~~~l~~A~~~Gin~~DTA~~Yg~g~se~~lG~al~~~---~~--~r~ 76 (298)
T d1ur3m_ 2 VQRITIAPQGPEFSRFVMGYWRLMDWNMSARQLVSFIEEHLDLGVTTVDHADIYGGYQCEAAFGEALKLA---PH--LRE 76 (298)
T ss_dssp CCEEECSTTCCEEESSEEECTTTTTTTCCHHHHHHHHHHHHHHTCCEEECCSSTTTTTHHHHHHHHHHHC---GG--GTT
T ss_pred CCceEeCCCCCEeCCEEEeCcccCCCCCCHHHHHHHHHHHHHcCCCEEEeccccCCcccccccccccccc---cc--chh
Confidence 7899999888999999999999875 7899999999999999999999999999 699999999975 44 799
Q ss_pred ceEEeeccCCC------------CCChhhHHHHHHHHHHHcCCCceeEeeeccCCCCCCCCCCCCCccCCCCCCCHHHHH
Q 028869 87 ELFIASKLWCS------------DAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEFPIKKEDFLPMDFKSVW 154 (202)
Q Consensus 87 ~~~I~tK~~~~------------~~~~~~i~~~~~~sL~~Lg~~~vDl~~lh~p~~~~~~~~~~~~~~~~~~~~~~~~~~ 154 (202)
+++|+||++.. ..+++.+++++++||++||++|+|+|++|++++..+ .+++|
T Consensus 77 ~~~i~tK~g~~~~~~~~~~~~~~~~s~~~i~~~~~~SL~rL~~d~iDl~~lH~~d~~~~----------------~~e~~ 140 (298)
T d1ur3m_ 77 RMEIVSKCGIATTAREENVIGHYITDRDHIIKSAEQSLINLATDHLDLLLIHRPDPLMD----------------ADEVA 140 (298)
T ss_dssp TCEEEEEECEECTTSTTCSSCEECCCHHHHHHHHHHHHHHHTCSCBSEEEECSCCTTCC----------------HHHHH
T ss_pred hhhhhhcccccccCCCcCcccCCCCCHHHHHHHHHhhhhhhccccccccccccccccch----------------hHHHH
Confidence 99999998532 467899999999999999999999999999987654 88999
Q ss_pred HHHHHHHHcCCccEEEeCCCCHHHHHHHHHhCCCCCeeeeeecccCc
Q 028869 155 EAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPAANQVSFLKKY 201 (202)
Q Consensus 155 ~~l~~l~~~G~ir~iGvSn~~~~~l~~l~~~~~~~p~~~Q~e~~~~~ 201 (202)
++|++++++|+||+||+|||++++++++...+...++.+|+++++.+
T Consensus 141 ~~l~~lk~~GkIr~iG~S~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 187 (298)
T d1ur3m_ 141 DAFKHLHQSGKVRHFGVSNFTPAQFALLQSRLPFTLATNQVEISPVH 187 (298)
T ss_dssp HHHHHHHHTTSBCCEEEESCCHHHHHHHHTTCSSCCCCEEEECBTTB
T ss_pred HHHHHhhccCcceeecCCCCcHHHHHHHHhhhcccccccccccCchh
Confidence 99999999999999999999999999999988888999999998764
|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2g0wa1 c.1.15.4 (A:10-284) Hypothetical protein Lmo2234 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|