Citrus Sinensis ID: 028897

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--

MKRPMPWGDQVDVISSDDSASDGDADNGLDGRQSSNDMTIDQPTKELTSEVENIQKQKCQGLNEKGSLFRRAEMYQEYMKQLPIPTQRSSIIPFTSWVGLGNSIKQLYEQPLHYLTNIHLKQWDQLRFGTEDEHKPLDSLVHPCKAEATVWLIEEVHRLTSCHHHLAKLWLSDPMHYVFIDSITLNSPKSPDSTKSSSPQVL

ccccccccccEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccccccccc

*****P*******************************************************LNEKGSLFRRAEMYQEYMKQLPIPTQRSSIIPFTSWVGLGNSIKQLYEQPLHYLTNIHLKQWDQLRFGTEDEHKPLDSLVHPCKAEATVWLIEEVHRLTSCHHHLAKLWLSDPMHYVFIDSITL*****************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein RDM1	Regulator of RNA-directed DNA methylation (RdDM). Binds to single-stranded methyl DNA.	probable	Q9LUJ3

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VK5, chain A
Confidence level:very confident
Coverage over the Query: 66-186
View the alignment between query and template
View the model in PyMOL