Citrus Sinensis ID: 028899


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MADNNPAGVDNTFRRKFDREEYLERAREREREEADGRSKSKAKGPPVQRKPLKHRDYVVDLESRLGKTQVVTPIAPLSQQAGYYCSVCECVVKDSANYLDHINGKKHQRALGMSMRVERASLDQVRERFELLKKRKVPGSFSEQDLDERIIKQQEEEEERRRQRREKKKEKKKEKAAVEEETEMDPDIAAMMGFGSFHSSKK
ccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHccHHHHcccEEEEcccccccccccccccccccccccHHHHHHHHccHHHHHHHcccccEEcccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHccccccccccc
***********TFRRKFDREEY*********************************DYVVDLESRLGKTQVVTPIAPLSQQAGYYCSVCECVVKDSANYLDHINGKK****************DQVRERFE***********************************************************AMMGFGSFH****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADNNPAGVDNTFRRKFDREEYLERAREREREEADGRSKSKAKGPPVQRKPLKHRDYVVDLESRLGKTQVVTPIAPLSQQAGYYCSVCECVVKDSANYLDHINGKKHQRALGMSMRVERASLDQVRERFELLKKRKVPGSFSEQDLDERIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDPDIAAMMGFGSFHSSKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger matrin-type protein 2 probableQ96NC0
Zinc finger matrin-type protein 2 probableQ9CPW7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F9C, chain B
Confidence level:probable
Coverage over the Query: 84-128
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 115-187
View the alignment between query and template
View the model in PyMOL