Citrus Sinensis ID: 028899
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| 224125038 | 197 | predicted protein [Populus trichocarpa] | 0.970 | 0.994 | 0.831 | 3e-78 | |
| 357123026 | 201 | PREDICTED: zinc finger matrin-type prote | 0.985 | 0.990 | 0.819 | 1e-77 | |
| 449490847 | 202 | PREDICTED: zinc finger matrin-type prote | 0.985 | 0.985 | 0.840 | 2e-77 | |
| 326509317 | 202 | predicted protein [Hordeum vulgare subsp | 0.985 | 0.985 | 0.809 | 1e-76 | |
| 194701682 | 201 | unknown [Zea mays] gi|194702922|gb|ACF85 | 0.985 | 0.990 | 0.783 | 2e-76 | |
| 449454034 | 202 | PREDICTED: LOW QUALITY PROTEIN: zinc fin | 0.985 | 0.985 | 0.830 | 9e-76 | |
| 242051785 | 201 | hypothetical protein SORBIDRAFT_03g00340 | 0.985 | 0.990 | 0.788 | 2e-75 | |
| 326499590 | 200 | predicted protein [Hordeum vulgare subsp | 0.975 | 0.985 | 0.804 | 7e-75 | |
| 115456395 | 202 | Os03g0831900 [Oryza sativa Japonica Grou | 0.985 | 0.985 | 0.83 | 1e-74 | |
| 255542866 | 202 | zinc finger protein, putative [Ricinus c | 1.0 | 1.0 | 0.871 | 2e-74 |
| >gi|224125038|ref|XP_002319487.1| predicted protein [Populus trichocarpa] gi|222857863|gb|EEE95410.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 296 bits (759), Expect = 3e-78, Method: Compositional matrix adjust.
Identities = 168/202 (83%), Positives = 184/202 (91%), Gaps = 6/202 (2%)
Query: 1 MADNNPAG-VDNTFRRKFDREEYLERAREREREEADGRSKSKAKGPPVQRKPLKHRDYVV 59
MA+NN G VDNTFRRKFD EEYLERARERE++EA+GR KSK+KGPPVQRKPLKHRDY V
Sbjct: 1 MANNNAGGSVDNTFRRKFDPEEYLERAREREKQEAEGRGKSKSKGPPVQRKPLKHRDYEV 60
Query: 60 DLESRLGKTQVVTPIAPLSQQAGYYCSVCECVVKDSANYLDHINGKKHQRALGMSMRVER 119
DL+SRLGKTQVVTPIAPLSQQAGYYCSVCECVVKDSANYLDHINGKKHQRALGMSMRVER
Sbjct: 61 DLDSRLGKTQVVTPIAPLSQQAGYYCSVCECVVKDSANYLDHINGKKHQRALGMSMRVER 120
Query: 120 ASLDQVRERFELLKKRKVPGSFSEQDLDERIIKQQEEEEERRRQRREKKKEKKKEKAAVE 179
ASL QV+ERFE LKKR+ PGSF+EQDLDERI+KQQEEEEER+RQRRE+KKEKK+E+ A
Sbjct: 121 ASLQQVQERFEKLKKRREPGSFTEQDLDERILKQQEEEEERKRQRRERKKEKKEEEEA-- 178
Query: 180 EETEMDPDIAAMMGFGSFHSSK 201
++DPDIAAMMGFG F S K
Sbjct: 179 ---DIDPDIAAMMGFGGFGSKK 197
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|357123026|ref|XP_003563214.1| PREDICTED: zinc finger matrin-type protein 2-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|449490847|ref|XP_004158724.1| PREDICTED: zinc finger matrin-type protein 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|326509317|dbj|BAJ91575.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|194701682|gb|ACF84925.1| unknown [Zea mays] gi|194702922|gb|ACF85545.1| unknown [Zea mays] gi|414875974|tpg|DAA53105.1| TPA: hypothetical protein ZEAMMB73_409857 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|449454034|ref|XP_004144761.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger matrin-type protein 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|242051785|ref|XP_002455038.1| hypothetical protein SORBIDRAFT_03g003400 [Sorghum bicolor] gi|241927013|gb|EES00158.1| hypothetical protein SORBIDRAFT_03g003400 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|326499590|dbj|BAJ86106.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|115456395|ref|NP_001051798.1| Os03g0831900 [Oryza sativa Japonica Group] gi|28372669|gb|AAO39853.1| unknown protein [Oryza sativa Japonica Group] gi|31249762|gb|AAP46254.1| unknown protein [Oryza sativa Japonica Group] gi|108711920|gb|ABF99715.1| expressed protein [Oryza sativa Japonica Group] gi|113550269|dbj|BAF13712.1| Os03g0831900 [Oryza sativa Japonica Group] gi|125546314|gb|EAY92453.1| hypothetical protein OsI_14186 [Oryza sativa Indica Group] gi|125588516|gb|EAZ29180.1| hypothetical protein OsJ_13239 [Oryza sativa Japonica Group] gi|215765481|dbj|BAG87178.1| unnamed protein product [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|255542866|ref|XP_002512496.1| zinc finger protein, putative [Ricinus communis] gi|223548457|gb|EEF49948.1| zinc finger protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| TAIR|locus:2074524 | 202 | AT3G05760 [Arabidopsis thalian | 0.717 | 0.717 | 0.739 | 2e-61 | |
| ZFIN|ZDB-GENE-030131-3197 | 198 | zmat2 "zinc finger, matrin typ | 0.678 | 0.691 | 0.535 | 2.2e-38 | |
| UNIPROTKB|Q5ZIF6 | 199 | ZMAT2 "Uncharacterized protein | 0.623 | 0.633 | 0.557 | 8.2e-37 | |
| UNIPROTKB|F1NDH4 | 199 | ZMAT2 "Uncharacterized protein | 0.618 | 0.628 | 0.561 | 1e-36 | |
| UNIPROTKB|Q0P584 | 199 | ZMAT2 "Uncharacterized protein | 0.623 | 0.633 | 0.557 | 1.3e-36 | |
| UNIPROTKB|E2QZ35 | 199 | ZMAT2 "Uncharacterized protein | 0.623 | 0.633 | 0.557 | 1.3e-36 | |
| UNIPROTKB|Q96NC0 | 199 | ZMAT2 "Zinc finger matrin-type | 0.623 | 0.633 | 0.557 | 1.3e-36 | |
| UNIPROTKB|I3LF90 | 199 | ZMAT2 "Uncharacterized protein | 0.623 | 0.633 | 0.557 | 1.3e-36 | |
| MGI|MGI:1913742 | 199 | Zmat2 "zinc finger, matrin typ | 0.623 | 0.633 | 0.557 | 1.3e-36 | |
| RGD|1583592 | 199 | Zmat2 "zinc finger, matrin typ | 0.623 | 0.633 | 0.557 | 3.5e-36 |
| TAIR|locus:2074524 AT3G05760 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 565 (203.9 bits), Expect = 2.0e-61, Sum P(2) = 2.0e-61
Identities = 108/146 (73%), Positives = 122/146 (83%)
Query: 2 ADNNPAGVDNTFRRKFDXXXXXXXXXXXXXXXADGRSKSKAKGPPVQRKPLKHRDYVVDL 61
+ N GVDNTFR+KFD +D RSKS++KGPPVQR PLKHRDY VDL
Sbjct: 3 SSNTTTGVDNTFRKKFDVEEFKERAREREKKESD-RSKSRSKGPPVQRAPLKHRDYHVDL 61
Query: 62 ESRLGKTQVVTPIAPLSQQAGYYCSVCECVVKDSANYLDHINGKKHQRALGMSMRVERAS 121
ESRLGKTQVVTP+APLSQQAGY+C VC+CVVKDSANYLDHINGKKHQRALGMSMRVER+S
Sbjct: 62 ESRLGKTQVVTPVAPLSQQAGYFCRVCDCVVKDSANYLDHINGKKHQRALGMSMRVERSS 121
Query: 122 LDQVRERFELLKKRKVPGSFSEQDLD 147
L+QV+ERFE+LKKRK PG+F+EQDLD
Sbjct: 122 LEQVQERFEVLKKRKAPGTFTEQDLD 147
|
|
| ZFIN|ZDB-GENE-030131-3197 zmat2 "zinc finger, matrin type 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZIF6 ZMAT2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NDH4 ZMAT2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0P584 ZMAT2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QZ35 ZMAT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96NC0 ZMAT2 "Zinc finger matrin-type protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LF90 ZMAT2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913742 Zmat2 "zinc finger, matrin type 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1583592 Zmat2 "zinc finger, matrin type 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_Genewise1_v1.C_LG_XIII0652 | hypothetical protein (198 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| smart00451 | 35 | smart00451, ZnF_U1, U1-like zinc finger | 6e-08 | |
| pfam12874 | 25 | pfam12874, zf-met, Zinc-finger of C2H2 type | 1e-05 | |
| pfam12171 | 27 | pfam12171, zf-C2H2_jaz, Zinc-finger double-strande | 1e-04 |
| >gnl|CDD|197732 smart00451, ZnF_U1, U1-like zinc finger | Back alignment and domain information |
|---|
Score = 46.9 bits (112), Expect = 6e-08
Identities = 10/30 (33%), Positives = 17/30 (56%)
Query: 82 GYYCSVCECVVKDSANYLDHINGKKHQRAL 111
G+YC +C D + H+ GKKH++ +
Sbjct: 3 GFYCKLCNVTFTDEISVEAHLKGKKHKKNV 32
|
Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins. Length = 35 |
| >gnl|CDD|205121 pfam12874, zf-met, Zinc-finger of C2H2 type | Back alignment and domain information |
|---|
| >gnl|CDD|204841 pfam12171, zf-C2H2_jaz, Zinc-finger double-stranded RNA-binding | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| KOG4727 | 193 | consensus U1-like Zn-finger protein [General funct | 100.0 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 98.78 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 98.71 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 98.44 | |
| PF08648 | 180 | DUF1777: Protein of unknown function (DUF1777); In | 98.01 | |
| PF06220 | 38 | zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi | 97.81 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.26 | |
| KOG3408 | 129 | consensus U1-like Zn-finger-containing protein, pr | 97.18 | |
| KOG3454 | 165 | consensus U1 snRNP-specific protein C [RNA process | 96.86 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 96.24 | |
| KOG2837 | 309 | consensus Protein containing a U1-type Zn-finger a | 95.98 | |
| KOG3263 | 196 | consensus Nucleic acid binding protein [General fu | 95.98 | |
| PF07535 | 49 | zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc | 95.85 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 95.68 | |
| COG5112 | 126 | UFD2 U1-like Zn-finger-containing protein [General | 95.55 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 95.25 | |
| PLN02748 | 468 | tRNA dimethylallyltransferase | 94.8 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 94.61 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 94.46 | |
| smart00586 | 49 | ZnF_DBF Zinc finger in DBF-like proteins. | 94.38 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 94.32 | |
| COG5188 | 470 | PRP9 Splicing factor 3a, subunit 3 [RNA processing | 93.8 | |
| COG4049 | 65 | Uncharacterized protein containing archaeal-type C | 93.37 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 93.23 | |
| PF03194 | 254 | LUC7: LUC7 N_terminus; InterPro: IPR004882 This fa | 93.1 | |
| KOG0150 | 336 | consensus Spliceosomal protein FBP21 [RNA processi | 91.09 | |
| KOG2785 | 390 | consensus C2H2-type Zn-finger protein [General fun | 90.92 | |
| KOG3032 | 264 | consensus Uncharacterized conserved protein [Funct | 89.58 | |
| PF11931 | 196 | DUF3449: Domain of unknown function (DUF3449); Int | 89.22 | |
| PF14968 | 336 | CCDC84: Coiled coil protein 84 | 87.05 | |
| PTZ00448 | 373 | hypothetical protein; Provisional | 86.37 | |
| KOG0796 | 319 | consensus Spliceosome subunit [RNA processing and | 85.28 | |
| KOG0227 | 222 | consensus Splicing factor 3a, subunit 2 [RNA proce | 85.15 | |
| PHA00616 | 44 | hypothetical protein | 84.88 |
| >KOG4727 consensus U1-like Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.6e-64 Score=411.29 Aligned_cols=191 Identities=59% Similarity=0.880 Sum_probs=168.8
Q ss_pred CCCCCCccccccCHHHHHHHHHhHHHHhhhcccccccCCCCCCCCCCcccccccchhhhcCCceEecCCCCCCCCCcccc
Q 028899 6 PAGVDNTFRRKFDREEYLERAREREREEADGRSKSKAKGPPVQRKPLKHRDYVVDLESRLGKTQVVTPIAPLSQQAGYYC 85 (202)
Q Consensus 6 ~~~~d~~~RRtWDreeYa~kA~~r~~~~~e~~~~~~~~~~~~~~~~Lk~R~~~ldL~~~lgK~~vv~~~~~~~~~~GfyC 85 (202)
..++.++||||||++||+..|++|....-. .+...+|+++++|++|+|.+||++.||+++||+..+|.+++|||||
T Consensus 3 ~~t~g~~~RRkwD~eEy~e~Ar~r~~d~~~----~~k~~~~vqre~L~~rdykvdl~sKLgkt~vitk~tp~sq~~GyyC 78 (193)
T KOG4727|consen 3 SGTTGNDFRRKWDKEEYEELARERLLDRIV----LKKDGPPVQREHLKHRDYKVDLESKLGKTVVITKSTPRSQKGGYYC 78 (193)
T ss_pred CCCCCcchhhccCHHHHHHHHHHhhhhhhH----HhhcCCchhHHHHhhhhhhhHhHhhccceeEeccCCcccccCceee
Confidence 345568899999999999999999876421 2235788999999999999999999999999999999999999999
Q ss_pred cCCCCccccchhhhhhhcCHHHHHHcCCCceeeeccHHHHHHHHHHHHHhhCCCCCCcccHHHHHHHHHHHHHHHHHHHH
Q 028899 86 SVCECVVKDSANYLDHINGKKHQRALGMSMRVERASLDQVRERFELLKKRKVPGSFSEQDLDERIIKQQEEEEERRRQRR 165 (202)
Q Consensus 86 ~vCd~~~kDs~~~ldH~n~k~H~~~~G~sm~VersTle~Vk~rl~~lk~kk~~~~~~~~~~~eRl~~~~eeEe~~r~~rk 165 (202)
+||||+|+||++|||||||+.|++++||||+|+|+||+||+.||+.++.+..+ ....++|++||.+.+++|++.+..++
T Consensus 79 dVCdcvvKDSinflDHiNgKkHqrnlgmsm~verst~~qv~erf~~~k~k~~~-~~ke~~vE~r~~e~qeee~rlkd~~k 157 (193)
T KOG4727|consen 79 DVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLDQVKERFEQNKKKMEE-KQKEYDVEERLRETQEEEERLKDTRK 157 (193)
T ss_pred eecceeehhhHHHHHHhccHHHHHHHhhhhcchhhhHHHHHHHHHHHHHhhhh-hhHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999995543 34688999999999999999999999
Q ss_pred HHHHHHHHHHHhhhhcCCCCHHHHHhcCCCCCCCCCC
Q 028899 166 EKKKEKKKEKAAVEEETEMDPDIAAMMGFGSFHSSKK 202 (202)
Q Consensus 166 ekkk~kk~~~~~~e~~~~~d~emaamMGF~gFGssKK 202 (202)
++++++|+...+. .+.+.+|+|+|||||||||+|||
T Consensus 158 EK~ke~K~~t~~d-i~~es~~~~~amMGFSgF~tsKk 193 (193)
T KOG4727|consen 158 EKKKEKKRATKED-IDFESKDEMAAMMGFSGFGTSKK 193 (193)
T ss_pred HHHHHHhhccccc-ccccccHHHHHHhCccccccCCC
Confidence 9997766664322 23345699999999999999997
|
|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >PF08648 DUF1777: Protein of unknown function (DUF1777); InterPro: IPR013957 This entry shows eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3454 consensus U1 snRNP-specific protein C [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2837 consensus Protein containing a U1-type Zn-finger and implicated in RNA splicing or processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3263 consensus Nucleic acid binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07535 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >smart00586 ZnF_DBF Zinc finger in DBF-like proteins | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >PF03194 LUC7: LUC7 N_terminus; InterPro: IPR004882 This family consists of several LUC7 protein homologues that are restricted to eukaryotes | Back alignment and domain information |
|---|
| >KOG0150 consensus Spliceosomal protein FBP21 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3032 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11931 DUF3449: Domain of unknown function (DUF3449); InterPro: IPR024598 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF14968 CCDC84: Coiled coil protein 84 | Back alignment and domain information |
|---|
| >PTZ00448 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0796 consensus Spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0227 consensus Splicing factor 3a, subunit 2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-04 |
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
Score = 39.4 bits (91), Expect = 2e-04
Identities = 14/74 (18%), Positives = 32/74 (43%), Gaps = 4/74 (5%)
Query: 115 MRVERASLDQVRERFEL-LKKRKVPGSFSEQDLDERIIKQQEEEEERRRQRREKKKEKKK 173
+ E S+ + RE L++ + S+ E K +++ EE +++ E+ ++ K
Sbjct: 80 LTQEPESIRKWREEQRKRLQEL---DAASKVMEQEWREKAKKDLEEWNQRQSEQVEKNKI 136
Query: 174 EKAAVEEETEMDPD 187
++ PD
Sbjct: 137 NNRIADKAFYQQPD 150
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| 3cw1_L | 77 | U1 small nuclear ribonucleoprotein C; PRE-mRNA spl | 98.47 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 97.67 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 97.54 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 96.93 | |
| 4dgw_A | 402 | PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A | 95.48 | |
| 1fu9_A | 36 | U-shaped transcriptional cofactor; zinc-finger, be | 95.21 | |
| 2yrk_A | 55 | Zinc finger homeobox protein 4; structure genomics | 94.64 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 94.48 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 94.29 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 94.05 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 93.83 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 93.79 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 93.73 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 93.68 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 93.51 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 92.45 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 92.45 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 93.33 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 93.3 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 93.27 | |
| 4f9c_B | 144 | Protein DBF4 homolog A; Ser/Thr protein kinase, tr | 93.26 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.12 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 93.06 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 92.04 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.81 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 92.53 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.49 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 92.47 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 92.37 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.29 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.22 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 92.18 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.17 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 91.96 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 91.92 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 91.86 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 91.65 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.62 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.56 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 91.56 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 91.51 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 91.44 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.25 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.25 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 91.23 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 91.2 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 91.19 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 91.17 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.16 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.15 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 91.12 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 91.06 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 90.95 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 90.9 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 90.86 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 90.83 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 90.8 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 90.75 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 90.71 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.69 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 90.56 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 90.5 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 90.48 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.45 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.44 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 90.44 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 90.42 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.38 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 90.37 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 90.37 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 90.36 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 90.35 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.35 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 90.24 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 90.23 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 90.23 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 90.18 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 90.18 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 90.16 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 90.14 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 90.13 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.11 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 90.08 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 90.07 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 90.05 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 90.04 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 90.02 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 89.99 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 89.97 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 89.96 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 89.94 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 89.93 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 89.91 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 89.88 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 89.76 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 89.7 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 89.69 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 89.69 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 89.68 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 89.64 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 89.64 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 89.63 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 89.62 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 89.6 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 89.56 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 89.53 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 89.52 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 89.52 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 89.49 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 89.48 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 89.46 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 89.43 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 89.38 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 89.37 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 89.35 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 89.34 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 89.28 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 89.26 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 89.24 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 89.23 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 89.2 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 89.19 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 89.17 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 89.1 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 89.05 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 89.02 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 89.0 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 88.96 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.95 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 88.9 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 88.87 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 88.84 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.77 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 88.68 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 88.68 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 88.68 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 88.68 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 88.66 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 88.63 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.45 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 88.33 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 88.21 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.19 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 88.12 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 87.98 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 87.97 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 87.92 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 87.9 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 87.8 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 87.74 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 87.72 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 87.49 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 87.45 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 87.42 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 87.29 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 87.26 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 87.24 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 87.09 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 86.98 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 86.97 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 86.8 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 86.65 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 86.39 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 86.33 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 85.66 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 85.41 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 85.34 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 85.01 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 84.88 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 84.78 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 84.65 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 84.64 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 84.53 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 84.51 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 84.38 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 84.32 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 84.28 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 84.22 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 84.1 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 84.09 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 83.92 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 83.92 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 83.79 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 83.66 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 83.6 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 83.51 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 82.46 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 82.33 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 82.1 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 81.84 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 81.7 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 81.02 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 80.96 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 80.9 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 80.7 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 80.27 |
| >3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A | Back alignment and structure |
|---|
Probab=98.47 E-value=4.7e-08 Score=70.89 Aligned_cols=31 Identities=29% Similarity=0.752 Sum_probs=28.4
Q ss_pred CcccccCCCCcc-ccchh-hhhhhcCHHHHHHc
Q 028899 81 AGYYCSVCECVV-KDSAN-YLDHINGKKHQRAL 111 (202)
Q Consensus 81 ~GfyC~vCd~~~-kDs~~-~ldH~n~k~H~~~~ 111 (202)
++|||++||+.| .||.+ +.+|+||.+|+++.
T Consensus 2 PkYyCdYCd~~lt~Ds~s~Rk~H~~G~kH~~nv 34 (77)
T 3cw1_L 2 PKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENV 34 (77)
T ss_pred CCcccccCCceecCCCHHHHHHHHccHHHHHHH
Confidence 589999999999 89887 89999999999764
|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A | Back alignment and structure |
|---|
| >2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f9c_B Protein DBF4 homolog A; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_B* 4f9b_B* 4f9a_B* | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 98.4 | |
| d2vrda1 | 61 | Spliceosomal protein U1C {Human (Homo sapiens) [Ta | 97.82 | |
| d1zu1a2 | 55 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 96.53 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 94.16 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 94.14 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 93.74 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 93.7 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 93.41 | |
| d2yrka1 | 48 | Zinc finger homeobox protein 4, ZFHX4 {Human (Homo | 93.28 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 92.99 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 92.96 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 92.87 | |
| d1fu9a_ | 36 | U-shaped transcription factor, different fingers { | 92.56 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 92.43 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 91.88 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 91.45 | |
| d1zu1a1 | 72 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 91.39 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 90.89 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 89.52 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 89.2 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 88.05 | |
| d2ghfa2 | 36 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 87.27 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 86.35 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 86.28 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 86.22 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 85.3 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 84.52 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 83.41 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 83.32 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 82.65 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 82.02 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 81.79 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 81.62 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 81.18 | |
| d2eppa1 | 53 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 80.15 |
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: HkH motif-containing C2H2 finger domain: Zinc finger protein 593, ZNF593 species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.40 E-value=3.5e-08 Score=68.18 Aligned_cols=32 Identities=25% Similarity=0.376 Sum_probs=28.9
Q ss_pred CCCcccccCCCCccccchhhhhhhcCHHHHHH
Q 028899 79 QQAGYYCSVCECVVKDSANYLDHINGKKHQRA 110 (202)
Q Consensus 79 ~~~GfyC~vCd~~~kDs~~~ldH~n~k~H~~~ 110 (202)
+.+-|||-+|++.|.+..+|..|++|++|.++
T Consensus 12 G~gqfYCv~C~K~F~se~~l~~H~ksKkHKrr 43 (67)
T d1zr9a1 12 GGGLHRCLACARYFIDSTNLKTHFRSKDHKKR 43 (67)
T ss_dssp GGGCSEETTTTEECSSHHHHHHHTTCHHHHHH
T ss_pred CCCEEecccccCccCCHHHHHHHHcccHHHHH
Confidence 44669999999999999999999999999754
|
| >d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|