Citrus Sinensis ID: 028931

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
MMISNTTRILLPSPPPTCLATRQLDHNPLILRRDQAGFTSRTDFSRKLSHTHNEIFNSKKIISSAQKRGISPPNNRNKTNKKAEVSASARYLHMSAHKVRRVIDQIRGRSYEETLMILELMPYRACYPIFKLIYSAAANGVHNMGFNEASLVIAKAEVNEATSAKRPRPKAQGRVHMIKRPTCHITVVLRDMSLDDEYAVS
cccccccccccccccccccccccccccccCEECcccccccccccccccccccccccccHHHHHHHHccccccccccccccccccEEEEEEEccccHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccEEEEEEEEccccccccccccccccccccccccccEEEEEEccccccccccc
*********LLP***************PLILRRD*****************************************************SARYLHMSAHKVRRVIDQIRGRSYEETLMILELMPYRACYPIFKLIYSAAANGVHNMGFNEASLVIAKAEVNEATSAKRPRPKAQGRVHMIKRPTCHITVVLRDMSL*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMISNTTRILLPSPPPTCLATRQLDHNPLILRRDQAGFTSRTDFSRKLSHTHNEIFNSKKIISSAQKRGISPPNNRNKTNKKAEVSASARYLHMSAHKVRRVIDQIRGRSYEETLMILELMPYRACYPIFKLIYSAAANGVHNMGFNEASLVIAKAEVNEATSAKRPRPKAQGRVHMIKRPTCHITVVLRDMSLDDEYAVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L22, chloroplastic The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome.probableA4GYV0
50S ribosomal protein L22, chloroplastic The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome.probableP56795
50S ribosomal protein L22, chloroplastic The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome.probableQ49KV9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain U
Confidence level:very confident
Coverage over the Query: 83-198
View the alignment between query and template
View the model in PyMOL