Citrus Sinensis ID: 028966


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
MSFTGPSMSSGGNTVRRAIEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLPNIKWICPTAPTRPMTIFGGFPSTAWFDVGDLSEDVPDDLEGLDAAAAHVVNLLSTEPTDIKLGVGGFSMGAATALYSATCFAHGKYGNGNPYPAKLSAVVGLSGWLPCSKFDFIYLLQFERLSIIAFFNSTRHKSYSFPGP
ccccccccccccccccccccccccEEEcccccccEEEEEEEcccccccccHHHHHcccccccEEEccccccccccccccccccccccccccccccHHcHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHccccccccccccccEEEEEEccccccccccHHHHHHHcccccEEEcccccccccccccc
ccccccccccccccccccEcccccEEEcccccccEEEEEEccccccHHHHHHHHHccccccEEEEEccccEEEEHHHccEEEEccccEccccccccEcHHHHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHHcccccccccccccEEEEEEcccccccccccccccHHccccHHHHcccccEEEEEcccc
msftgpsmssggntVRRAIEFGRtyvvrpkgkhQATVVWLhglgdngsswsqlletlplpnikwicptaptrpmtifggfpstawfdvgdlsedvpddlEGLDAAAAHVVNLlsteptdiklgvggFSMGAATALYSATcfahgkygngnpypakLSAVVglsgwlpcskfdfIYLLQFERLSIIAFfnstrhksysfpgp
msftgpsmssggntVRRAIEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLPNIKWICPTAPTRPMTIFGGFPSTAWFDVGDLSEDVPDDLEGLDAAAAHVVNLLSTEPTDIKLGVGGFSMGAATALYSATCFAHGKYGNGNPYPAKLSAVVGLSGWLPCSKFDFIYLLQFERLSIIAFFnstrhksysfpgp
MSFTGPSMSSGGNTVRRAIEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLPNIKWICPTAPTRPMTIFGGFPSTAWFDVGDLSEDVPDDLEGLDAAAAHVVNLLSTEPTDIKLGVGGFSMGAATALYSATCFAHGKYGNGNPYPAKLSAVVGLSGWLPCSKFDFIYLLQFERLSIIAFFNSTRHKSYSFPGP
***************RRAIEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLPNIKWICPTAPTRPMTIFGGFPSTAWFDVGDLSEDVPDDLEGLDAAAAHVVNLLSTEPTDIKLGVGGFSMGAATALYSATCFAHGKYGNGNPYPAKLSAVVGLSGWLPCSKFDFIYLLQFERLSIIAFFNS***********
************************YVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLPNIKWICPTAPTRPMTIFGGFPSTAWFDVGDLSEDVPDDLEGLDAAAAHVVNLLSTEPTDIKLGVGGFSMGAATALYSATCFAHGKYGNGNPYPAKLSAVVGLSGWLPCSK*************IIAFFNSTRHKSYSFP**
***********GNTVRRAIEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLPNIKWICPTAPTRPMTIFGGFPSTAWFDVGDLSEDVPDDLEGLDAAAAHVVNLLSTEPTDIKLGVGGFSMGAATALYSATCFAHGKYGNGNPYPAKLSAVVGLSGWLPCSKFDFIYLLQFERLSIIAFFNSTR*********
***************RRAIEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLPNIKWICPTAPTRPMTIFGGFPSTAWFDVGDLSEDVPDDLEGLDAAAAHVVNLLSTEPTDIKLGVGGFSMGAATALYSATCFAHGKYGNGNPYPAKLSAVVGLSGWLPCSKFDFIYLLQFERLSIIAFFNSTRHKSYSFPG*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFTGPSMSSGGNTVRRAIEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLPNIKWICPTAPTRPMTIFGGFPSTAWFDVGDLSEDVPDDLEGLDAAAAHVVNLLSTEPTDIKLGVGGFSMGAATALYSATCFAHGKYGNGNPYPAKLSAVVGLSGWLPCSKFDFIYLLQFERLSIIAFFNSTRHKSYSFPGP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query201 2.2.26 [Sep-21-2011]
Q9QYL8231 Acyl-protein thioesterase yes no 0.626 0.545 0.393 3e-20
Q9WTL7231 Acyl-protein thioesterase yes no 0.626 0.545 0.393 3e-20
O95372231 Acyl-protein thioesterase yes no 0.626 0.545 0.393 3e-20
O42881224 Acyl-protein thioesterase yes no 0.681 0.611 0.346 4e-18
O77821230 Acyl-protein thioesterase no no 0.646 0.565 0.367 4e-17
P97823230 Acyl-protein thioesterase no no 0.646 0.565 0.367 4e-17
Q5RBR7230 Acyl-protein thioesterase no no 0.646 0.565 0.353 5e-17
O75608230 Acyl-protein thioesterase no no 0.646 0.565 0.353 7e-17
Q54T49226 Acyl-protein thioesterase yes no 0.686 0.610 0.324 1e-16
P70470230 Acyl-protein thioesterase no no 0.646 0.565 0.360 5e-16
>sp|Q9QYL8|LYPA2_RAT Acyl-protein thioesterase 2 OS=Rattus norvegicus GN=Lypla2 PE=1 SV=1 Back     alignment and function desciption
 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 84/145 (57%), Gaps = 19/145 (13%)

Query: 32  KHQATVVWLHGLGDNGSSWSQLLETLPLPNIKWICPTAPTRPMTIFGGFPSTAWFDVGDL 91
           +  A V++LHGLGD G SW+  L T+ LP++K+ICP AP  P+T+       +WFD+  L
Sbjct: 22  RETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGL 81

Query: 92  SEDVPDDLEGLDAAAAHVVNLLSTE-----PTDIKLGVGGFSMGAATALYSA-TCFAHGK 145
           S D P+D  G+  AA ++  L+  E     P + ++ +GGFS G A +LY+A TC     
Sbjct: 82  SPDAPEDEAGIKKAAENIKALIEHEMKNGIPAN-RIVLGGFSQGGALSLYTALTC----- 135

Query: 146 YGNGNPYPAKLSAVVGLSGWLPCSK 170
                P+P  L+ +V LS WLP  +
Sbjct: 136 -----PHP--LAGIVALSCWLPLHR 153




May hydrolyze fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS (By similarity). Has lysophospholipase activity.
Rattus norvegicus (taxid: 10116)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: -
>sp|Q9WTL7|LYPA2_MOUSE Acyl-protein thioesterase 2 OS=Mus musculus GN=Lypla2 PE=1 SV=1 Back     alignment and function description
>sp|O95372|LYPA2_HUMAN Acyl-protein thioesterase 2 OS=Homo sapiens GN=LYPLA2 PE=1 SV=1 Back     alignment and function description
>sp|O42881|APTH1_SCHPO Acyl-protein thioesterase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8E11.04c PE=3 SV=1 Back     alignment and function description
>sp|O77821|LYPA1_RABIT Acyl-protein thioesterase 1 OS=Oryctolagus cuniculus GN=LYPLA1 PE=1 SV=1 Back     alignment and function description
>sp|P97823|LYPA1_MOUSE Acyl-protein thioesterase 1 OS=Mus musculus GN=Lypla1 PE=1 SV=1 Back     alignment and function description
>sp|Q5RBR7|LYPA1_PONAB Acyl-protein thioesterase 1 OS=Pongo abelii GN=LYPLA1 PE=2 SV=1 Back     alignment and function description
>sp|O75608|LYPA1_HUMAN Acyl-protein thioesterase 1 OS=Homo sapiens GN=LYPLA1 PE=1 SV=1 Back     alignment and function description
>sp|Q54T49|APT11_DICDI Acyl-protein thioesterase 1 homolog 1 OS=Dictyostelium discoideum GN=DDB_G0282005 PE=2 SV=1 Back     alignment and function description
>sp|P70470|LYPA1_RAT Acyl-protein thioesterase 1 OS=Rattus norvegicus GN=Lypla1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
255566923258 Acyl-protein thioesterase, putative [Ric 0.845 0.658 0.882 2e-84
359484394 720 PREDICTED: probable receptor-like protei 0.840 0.234 0.876 5e-83
118487334256 unknown [Populus trichocarpa] 0.845 0.664 0.864 8e-83
358249352258 uncharacterized protein LOC100796190 [Gl 0.845 0.658 0.859 1e-82
356516949258 PREDICTED: acyl-protein thioesterase 2-l 0.845 0.658 0.853 1e-81
297738914256 unnamed protein product [Vitis vinifera] 0.840 0.660 0.876 1e-81
388493452189 unknown [Lotus japonicus] 0.835 0.888 0.847 6e-81
388492300255 unknown [Lotus japonicus] gi|388517447|g 0.835 0.658 0.847 8e-81
449464590252 PREDICTED: acyl-protein thioesterase 2-l 0.845 0.674 0.864 4e-78
388499722255 unknown [Medicago truncatula] 0.835 0.658 0.823 4e-78
>gi|255566923|ref|XP_002524444.1| Acyl-protein thioesterase, putative [Ricinus communis] gi|223536232|gb|EEF37884.1| Acyl-protein thioesterase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 158/170 (92%)

Query: 1   MSFTGPSMSSGGNTVRRAIEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLP 60
           MSFTGPS+ +GG T RRA EFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLP
Sbjct: 1   MSFTGPSVGAGGKTARRAFEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLP 60

Query: 61  NIKWICPTAPTRPMTIFGGFPSTAWFDVGDLSEDVPDDLEGLDAAAAHVVNLLSTEPTDI 120
           NIKWICPTAPT+P+T+FGGFPSTAWFDVGDLSED PDDLEG+DAAAAHV NLLSTEP DI
Sbjct: 61  NIKWICPTAPTQPITVFGGFPSTAWFDVGDLSEDAPDDLEGMDAAAAHVANLLSTEPADI 120

Query: 121 KLGVGGFSMGAATALYSATCFAHGKYGNGNPYPAKLSAVVGLSGWLPCSK 170
           KLG+GGFSMGAAT+LYSATCF  GKY NG PYPA LSAVVGLSGWLPCSK
Sbjct: 121 KLGIGGFSMGAATSLYSATCFTLGKYANGIPYPANLSAVVGLSGWLPCSK 170




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359484394|ref|XP_002285029.2| PREDICTED: probable receptor-like protein kinase At5g20050 [Vitis vinifera] Back     alignment and taxonomy information
>gi|118487334|gb|ABK95495.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|358249352|ref|NP_001239784.1| uncharacterized protein LOC100796190 [Glycine max] gi|255642102|gb|ACU21317.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356516949|ref|XP_003527153.1| PREDICTED: acyl-protein thioesterase 2-like [Glycine max] Back     alignment and taxonomy information
>gi|297738914|emb|CBI28159.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388493452|gb|AFK34792.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388492300|gb|AFK34216.1| unknown [Lotus japonicus] gi|388517447|gb|AFK46785.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449464590|ref|XP_004150012.1| PREDICTED: acyl-protein thioesterase 2-like [Cucumis sativus] gi|449526535|ref|XP_004170269.1| PREDICTED: acyl-protein thioesterase 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388499722|gb|AFK37927.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
TAIR|locus:2147650252 AT5G20060 "AT5G20060" [Arabido 0.840 0.670 0.8 6.3e-76
TAIR|locus:2035064255 AT1G52700 "AT1G52700" [Arabido 0.825 0.650 0.712 3.7e-64
TAIR|locus:1005716739231 AT1G52695 [Arabidopsis thalian 0.761 0.662 0.425 1.8e-30
TAIR|locus:2008271212 AT1G51300 [Arabidopsis thalian 0.457 0.433 0.405 2e-30
TAIR|locus:2826810186 AT1G47786 [Arabidopsis thalian 0.736 0.795 0.420 3.5e-27
TAIR|locus:2202395126 AT1G47780 [Arabidopsis thalian 0.502 0.801 0.504 4.2e-24
WB|WBGene00010564223 ath-1 [Caenorhabditis elegans 0.706 0.636 0.372 5.5e-22
UNIPROTKB|J9PAN4231 LYPLA2 "Uncharacterized protei 0.611 0.532 0.401 4.9e-21
UNIPROTKB|O95372231 LYPLA2 "Acyl-protein thioester 0.611 0.532 0.401 4.9e-21
UNIPROTKB|Q5QPQ2182 LYPLA2 "Acyl-protein thioester 0.611 0.675 0.401 4.9e-21
TAIR|locus:2147650 AT5G20060 "AT5G20060" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 765 (274.4 bits), Expect = 6.3e-76, P = 6.3e-76
 Identities = 136/170 (80%), Positives = 156/170 (91%)

Query:     1 MSFTGPSMSSGGNTVRRAIEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLP 60
             MS +G ++ SG N +RRA+EFG+T+VVRPKGKHQAT+VWLHGLGDNGSSWSQLLETLPLP
Sbjct:     1 MSISGAAVGSGRN-LRRAVEFGKTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLETLPLP 59

Query:    61 NIKWICPTAPTRPMTIFGGFPSTAWFDVGDLSEDVPDDLEGLDAAAAHVVNLLSTEPTDI 120
             NIKWICPTAP++P+++FGGFPSTAWFDV D++ED PDD+EGLD AAAHV NLLS EP DI
Sbjct:    60 NIKWICPTAPSQPISLFGGFPSTAWFDVVDINEDGPDDMEGLDVAAAHVANLLSNEPADI 119

Query:   121 KLGVGGFSMGAATALYSATCFAHGKYGNGNPYPAKLSAVVGLSGWLPCSK 170
             KLGVGGFSMGAAT+LYSATCFA GKYGNGNPYP  LSA++GLSGWLPC+K
Sbjct:   120 KLGVGGFSMGAATSLYSATCFALGKYGNGNPYPINLSAIIGLSGWLPCAK 169




GO:0004091 "carboxylesterase activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0016787 "hydrolase activity" evidence=IEA
TAIR|locus:2035064 AT1G52700 "AT1G52700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716739 AT1G52695 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008271 AT1G51300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826810 AT1G47786 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202395 AT1G47780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00010564 ath-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|J9PAN4 LYPLA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O95372 LYPLA2 "Acyl-protein thioesterase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5QPQ2 LYPLA2 "Acyl-protein thioesterase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
pfam02230213 pfam02230, Abhydrolase_2, Phospholipase/Carboxyles 2e-33
COG0400207 COG0400, COG0400, Predicted esterase [General func 6e-09
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 3e-05
pfam12695145 pfam12695, Abhydrolase_5, Alpha/beta hydrolase fam 0.003
>gnl|CDD|216940 pfam02230, Abhydrolase_2, Phospholipase/Carboxylesterase Back     alignment and domain information
 Score =  118 bits (297), Expect = 2e-33
 Identities = 55/150 (36%), Positives = 74/150 (49%), Gaps = 22/150 (14%)

Query: 26  VVRPKGKHQATVVWLHGLGDNGSSWS-QLLETLPLPNIKWICPTAPTRPMTIFGGFPSTA 84
           +  P    QATV++LHGLGD G  W+       PLP+ K+I P  P RP+T+ GG    A
Sbjct: 3   IESPAKPAQATVIFLHGLGDTGHGWAFAAKCEAPLPHTKFIFPHGPERPVTLNGGMRMPA 62

Query: 85  WFDVGDLSEDVPDDLEGLDAAAAHVVNLLSTEPTDIKLGV-------GGFSMGAATALYS 137
           WFD+  LS +  +D  G+  +A  +  L+  E   +K G+       GGFS GAA ALY 
Sbjct: 63  WFDIVGLSPNASEDEAGIKNSAETIEELIDAE---LKTGIPASRIIIGGFSQGAAVALY- 118

Query: 138 ATCFAHGKYGNGNPYPAKLSAVVGLSGWLP 167
            T             P  L  ++  SG LP
Sbjct: 119 -TALT---------SPQPLGGIIAFSGALP 138


This family consists of both phospholipases and carboxylesterases with broad substrate specificity, and is structurally related to alpha/beta hydrolases pfam00561. Length = 213

>gnl|CDD|223477 COG0400, COG0400, Predicted esterase [General function prediction only] Back     alignment and domain information
>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|221718 pfam12695, Abhydrolase_5, Alpha/beta hydrolase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 201
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 99.85
KOG2112206 consensus Lysophospholipase [Lipid transport and m 99.68
PRK00870 302 haloalkane dehalogenase; Provisional 99.67
TIGR02240 276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.65
PLN02211 273 methyl indole-3-acetate methyltransferase 99.65
COG0400207 Predicted esterase [General function prediction on 99.64
PLN02965 255 Probable pheophorbidase 99.64
PLN02824 294 hydrolase, alpha/beta fold family protein 99.63
TIGR03611 257 RutD pyrimidine utilization protein D. This protei 99.6
PHA02857 276 monoglyceride lipase; Provisional 99.6
PRK11126 242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.59
PLN02679 360 hydrolase, alpha/beta fold family protein 99.58
PRK11460232 putative hydrolase; Provisional 99.58
PRK10673 255 acyl-CoA esterase; Provisional 99.57
PRK03592 295 haloalkane dehalogenase; Provisional 99.57
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.57
PLN02385 349 hydrolase; alpha/beta fold family protein 99.56
TIGR03056 278 bchO_mg_che_rel putative magnesium chelatase acces 99.56
TIGR02427 251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.55
KOG4178 322 consensus Soluble epoxide hydrolase [Lipid transpo 99.55
TIGR03695 251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.54
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 99.52
TIGR03343 282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.52
PRK10749 330 lysophospholipase L2; Provisional 99.52
PLN02298 330 hydrolase, alpha/beta fold family protein 99.52
PRK06489 360 hypothetical protein; Provisional 99.51
PLN02578 354 hydrolase 99.51
PLN03084 383 alpha/beta hydrolase fold protein; Provisional 99.51
PRK10349 256 carboxylesterase BioH; Provisional 99.5
PRK03204 286 haloalkane dehalogenase; Provisional 99.5
TIGR01738 245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.49
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.48
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 99.47
COG2267 298 PldB Lysophospholipase [Lipid metabolism] 99.47
TIGR01250 288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.47
PLN03087 481 BODYGUARD 1 domain containing hydrolase; Provision 99.45
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.44
PRK08775 343 homoserine O-acetyltransferase; Provisional 99.43
PLN02894 402 hydrolase, alpha/beta fold family protein 99.4
KOG2564 343 consensus Predicted acetyltransferases and hydrola 99.39
PLN02652 395 hydrolase; alpha/beta fold family protein 99.38
TIGR01392 351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 99.38
COG1647243 Esterase/lipase [General function prediction only] 99.38
TIGR01249 306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 99.37
KOG4409 365 consensus Predicted hydrolase/acyltransferase (alp 99.36
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 99.33
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 99.32
PRK00175 379 metX homoserine O-acetyltransferase; Provisional 99.31
PRK07581 339 hypothetical protein; Validated 99.31
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 99.31
PRK05855 582 short chain dehydrogenase; Validated 99.3
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.28
PLN02442283 S-formylglutathione hydrolase 99.27
KOG1455 313 consensus Lysophospholipase [Lipid transport and m 99.27
PLN02511 388 hydrolase 99.26
KOG1454 326 consensus Predicted hydrolase/acyltransferase (alp 99.26
PF10503220 Esterase_phd: Esterase PHB depolymerase 99.26
PRK10566249 esterase; Provisional 99.26
PRK10985 324 putative hydrolase; Provisional 99.24
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 99.23
TIGR03100 274 hydr1_PEP hydrolase, ortholog 1, exosortase system 99.22
TIGR01607 332 PST-A Plasmodium subtelomeric family (PST-A). Thes 99.22
PLN00021 313 chlorophyllase 99.2
PRK13604 307 luxD acyl transferase; Provisional 99.2
PRK11071190 esterase YqiA; Provisional 99.2
PRK05077414 frsA fermentation/respiration switch protein; Revi 99.19
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 99.16
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 99.06
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 99.04
TIGR01836 350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 99.02
PRK10162318 acetyl esterase; Provisional 98.99
PF06342 297 DUF1057: Alpha/beta hydrolase of unknown function 98.94
PRK06765 389 homoserine O-acetyltransferase; Provisional 98.92
PLN02872 395 triacylglycerol lipase 98.9
TIGR03502 792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 98.89
COG0596 282 MhpC Predicted hydrolases or acyltransferases (alp 98.88
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 98.85
KOG2382 315 consensus Predicted alpha/beta hydrolase [General 98.84
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 98.81
COG0412236 Dienelactone hydrolase and related enzymes [Second 98.81
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 98.81
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 98.81
PRK07868 994 acyl-CoA synthetase; Validated 98.8
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 98.78
COG4099387 Predicted peptidase [General function prediction o 98.77
PF00561 230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 98.74
COG3319 257 Thioesterase domains of type I polyketide synthase 98.68
COG0429 345 Predicted hydrolase of the alpha/beta-hydrolase fo 98.68
KOG1838 409 consensus Alpha/beta hydrolase [General function p 98.67
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 98.63
PF07224 307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 98.62
COG3208244 GrsT Predicted thioesterase involved in non-riboso 98.6
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 98.6
PRK102521296 entF enterobactin synthase subunit F; Provisional 98.58
KOG1552258 consensus Predicted alpha/beta hydrolase [General 98.56
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 98.5
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 98.49
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 98.48
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 98.48
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 98.46
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 98.45
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 98.44
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 98.43
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 98.42
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 98.42
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 98.41
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 98.41
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 98.39
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 98.37
COG0657312 Aes Esterase/lipase [Lipid metabolism] 98.37
PF00151 331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 98.36
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 98.34
PF03403 379 PAF-AH_p_II: Platelet-activating factor acetylhydr 98.32
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 98.29
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 98.27
COG2021 368 MET2 Homoserine acetyltransferase [Amino acid tran 98.27
PRK10115686 protease 2; Provisional 98.22
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 98.22
PF10230 266 DUF2305: Uncharacterised conserved protein (DUF230 98.21
COG4188 365 Predicted dienelactone hydrolase [General function 98.21
KOG2984277 consensus Predicted hydrolase [General function pr 98.19
KOG3847399 consensus Phospholipase A2 (platelet-activating fa 98.17
COG4814288 Uncharacterized protein with an alpha/beta hydrola 98.17
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 98.16
COG4782 377 Uncharacterized protein conserved in bacteria [Fun 98.14
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 98.09
COG1075 336 LipA Predicted acetyltransferases and hydrolases w 98.04
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 98.01
TIGR01839 560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 98.01
PF00135 535 COesterase: Carboxylesterase family The prints ent 98.0
PF03096 283 Ndr: Ndr family; InterPro: IPR004142 This family c 97.98
PF10340 374 DUF2424: Protein of unknown function (DUF2424); In 97.97
KOG2624 403 consensus Triglyceride lipase-cholesterol esterase 97.95
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 97.94
KOG2931 326 consensus Differentiation-related gene 1 protein ( 97.94
PLN02633 314 palmitoyl protein thioesterase family protein 97.93
PRK04940180 hypothetical protein; Provisional 97.93
KOG2565 469 consensus Predicted hydrolases or acyltransferases 97.93
KOG4667269 consensus Predicted esterase [Lipid transport and 97.93
COG0627316 Predicted esterase [General function prediction on 97.89
KOG3101283 consensus Esterase D [General function prediction 97.81
KOG2541 296 consensus Palmitoyl protein thioesterase [Lipid tr 97.8
KOG2281867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 97.78
PLN02606 306 palmitoyl-protein thioesterase 97.78
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 97.76
PF02129 272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 97.75
KOG3724 973 consensus Negative regulator of COPII vesicle form 97.72
PF08538 303 DUF1749: Protein of unknown function (DUF1749); In 97.71
TIGR01849 406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 97.67
PF09752 348 DUF2048: Uncharacterized conserved protein (DUF204 97.66
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 97.57
PF02089 279 Palm_thioest: Palmitoyl protein thioesterase; Inte 97.56
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 97.46
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 97.46
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 97.39
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 97.37
KOG3043242 consensus Predicted hydrolase related to dienelact 97.3
COG2945210 Predicted hydrolase of the alpha/beta superfamily 97.29
KOG3975 301 consensus Uncharacterized conserved protein [Funct 97.18
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 97.16
COG2819264 Predicted hydrolase of the alpha/beta superfamily 97.15
PF02273 294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 96.99
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 96.85
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 96.69
COG3150191 Predicted esterase [General function prediction on 96.69
KOG1516 545 consensus Carboxylesterase and related proteins [G 96.61
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 96.58
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 96.46
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 96.41
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 96.4
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 96.39
PF00450 415 Peptidase_S10: Serine carboxypeptidase; InterPro: 96.35
KOG1553 517 consensus Predicted alpha/beta hydrolase BAT5 [Gen 96.29
COG1770682 PtrB Protease II [Amino acid transport and metabol 96.29
KOG2237712 consensus Predicted serine protease [Posttranslati 96.25
KOG4840 299 consensus Predicted hydrolases or acyltransferases 96.15
PF08840 213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 96.13
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 96.11
PF03583 290 LIP: Secretory lipase ; InterPro: IPR005152 This e 96.09
COG4757281 Predicted alpha/beta hydrolase [General function p 96.08
PF04301213 DUF452: Protein of unknown function (DUF452); Inte 96.01
PLN02454 414 triacylglycerol lipase 95.98
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 95.97
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 95.96
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 95.84
PLN02408365 phospholipase A1 95.77
PLN02162 475 triacylglycerol lipase 95.69
PLN02571 413 triacylglycerol lipase 95.59
PLN00413 479 triacylglycerol lipase 95.51
PLN02209 437 serine carboxypeptidase 95.39
KOG2369 473 consensus Lecithin:cholesterol acyltransferase (LC 95.08
PLN03016 433 sinapoylglucose-malate O-sinapoyltransferase 95.06
KOG1282 454 consensus Serine carboxypeptidases (lysosomal cath 94.99
PF08237225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 94.95
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 94.91
KOG3253 784 consensus Predicted alpha/beta hydrolase [General 94.88
PLN02934 515 triacylglycerol lipase 94.88
PF05705240 DUF829: Eukaryotic protein of unknown function (DU 94.85
COG3243 445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 94.82
PLN02802 509 triacylglycerol lipase 94.81
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 94.73
PLN02324 415 triacylglycerol lipase 94.69
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 94.66
KOG2183 492 consensus Prolylcarboxypeptidase (angiotensinase C 94.54
PLN02310 405 triacylglycerol lipase 94.48
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 94.26
PLN02847 633 triacylglycerol lipase 94.23
PLN03037 525 lipase class 3 family protein; Provisional 94.23
COG2936 563 Predicted acyl esterases [General function predict 94.18
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 94.18
COG4947227 Uncharacterized protein conserved in bacteria [Fun 94.11
KOG3967297 consensus Uncharacterized conserved protein [Funct 93.64
PLN02753 531 triacylglycerol lipase 93.26
PLN02719 518 triacylglycerol lipase 92.96
PF0408363 Abhydro_lipase: Partial alpha/beta-hydrolase lipas 92.93
KOG4569336 consensus Predicted lipase [Lipid transport and me 92.51
PLN02213 319 sinapoylglucose-malate O-sinapoyltransferase/ carb 91.94
PLN02761 527 lipase class 3 family protein 91.63
KOG2385 633 consensus Uncharacterized conserved protein [Funct 91.0
KOG2182 514 consensus Hydrolytic enzymes of the alpha/beta hyd 90.86
COG2939 498 Carboxypeptidase C (cathepsin A) [Amino acid trans 88.32
KOG4372 405 consensus Predicted alpha/beta hydrolase [General 85.43
KOG1283 414 consensus Serine carboxypeptidases [Posttranslatio 84.17
PF06441112 EHN: Epoxide hydrolase N terminus; InterPro: IPR01 84.05
PF11144 403 DUF2920: Protein of unknown function (DUF2920); In 83.6
KOG1551 371 consensus Uncharacterized conserved protein [Funct 80.22
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
Probab=99.85  E-value=6.9e-21  Score=154.19  Aligned_cols=162  Identities=37%  Similarity=0.631  Sum_probs=107.4

Q ss_pred             eeeeCCCCCCccEEEEEecCCCCchhhHHHHh-hCCCCCeEEEeeCCCCCCCcCCCCCcccccccCCCCCCCCCCchhHH
Q 028966           24 TYVVRPKGKHQATVVWLHGLGDNGSSWSQLLE-TLPLPNIKWICPTAPTRPMTIFGGFPSTAWFDVGDLSEDVPDDLEGL  102 (201)
Q Consensus        24 ~~~~~~~~~~~~~vl~lHG~g~~~~~~~~~~~-~l~~~~~~vi~~d~p~~~~~~~~g~~~~~w~~~~~~~~~~~~~~~~~  102 (201)
                      ..++.|..++.++||||||+|+++..|..+.. .+..+...+++|++|.......++...++||+....+.+...+...+
T Consensus         4 ~~i~~~~~~~~~lvi~LHG~G~~~~~~~~~~~~~~~~~~~~~i~p~ap~~~~~~~~g~~~~~Wf~~~~~~~~~~~~~~~i   83 (216)
T PF02230_consen    4 PRIIEPKGKAKPLVILLHGYGDSEDLFALLAELNLALPNTRFISPRAPSRPVTVPGGYRMPAWFDIYDFDPEGPEDEAGI   83 (216)
T ss_dssp             -EEE--SST-SEEEEEE--TTS-HHHHHHHHHHHTCSTTEEEEEE---EEE-GGGTT-EEE-SS-BSCSSSSSEB-HHHH
T ss_pred             CEEeCCCCCCceEEEEECCCCCCcchhHHHHhhcccCCceEEEeccCCCCCcccccccCCCceeeccCCCcchhhhHHHH
Confidence            35667778889999999999999988888777 45557899999999976555555655569999887665555677888


Q ss_pred             HHHHHHHHHHHhcCC----CCCcEEEEEeChhHHHHHHHHHhhhcCCCCCCCCCCCCccEEEEecccCCCcchhHHHHhh
Q 028966          103 DAAAAHVVNLLSTEP----TDIKLGVGGFSMGAATALYSATCFAHGKYGNGNPYPAKLSAVVGLSGWLPCSKFDFIYLLQ  178 (201)
Q Consensus       103 ~~~~~~l~~~i~~~~----~~~~~~LiG~S~Gg~~a~~~a~~~~~~~~~~~~~~p~~~~~li~~sg~~~~~~~~~~~~~~  178 (201)
                      .+.++.+.++|+.+.    ..++++|+||||||++++.+++           ++|+.++++|++||+++.......   .
T Consensus        84 ~~s~~~l~~li~~~~~~~i~~~ri~l~GFSQGa~~al~~~l-----------~~p~~~~gvv~lsG~~~~~~~~~~---~  149 (216)
T PF02230_consen   84 EESAERLDELIDEEVAYGIDPSRIFLGGFSQGAAMALYLAL-----------RYPEPLAGVVALSGYLPPESELED---R  149 (216)
T ss_dssp             HHHHHHHHHHHHHHHHTT--GGGEEEEEETHHHHHHHHHHH-----------CTSSTSSEEEEES---TTGCCCHC---C
T ss_pred             HHHHHHHHHHHHHHHHcCCChhheehhhhhhHHHHHHHHHH-----------HcCcCcCEEEEeeccccccccccc---c
Confidence            888888888877532    2258999999999999999995           789999999999999987655321   2


Q ss_pred             hhccccchhhhccceeeecCC
Q 028966          179 FERLSIIAFFNSTRHKSYSFP  199 (201)
Q Consensus       179 ~~~~~~~~~~~~~~~~~~~~~  199 (201)
                      .+....+++|..+...|-.+|
T Consensus       150 ~~~~~~~pi~~~hG~~D~vvp  170 (216)
T PF02230_consen  150 PEALAKTPILIIHGDEDPVVP  170 (216)
T ss_dssp             HCCCCTS-EEEEEETT-SSST
T ss_pred             ccccCCCcEEEEecCCCCccc
Confidence            233346677777666655544



; GO: 0016787 hydrolase activity; PDB: 3U0V_A 1AUR_A 1AUO_B 1FJ2_B 3CN9_A 3CN7_A.

>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>PLN02633 palmitoyl protein thioesterase family protein Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF04301 DUF452: Protein of unknown function (DUF452); InterPro: IPR007398 This is a family of uncharacterised proteins Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3967 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function Back     alignment and domain information
>KOG4569 consensus Predicted lipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>KOG2385 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4372 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06441 EHN: Epoxide hydrolase N terminus; InterPro: IPR010497 This entry represents the N-terminal region of the eukaryotic epoxide hydrolase protein Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>KOG1551 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
1fj2_A232 Crystal Structure Of The Human Acyl Protein Thioest 7e-18
3u0v_A239 Crystal Structure Analysis Of Human Lyplal1 Length 3e-15
1auo_A218 Carboxylesterase From Pseudomonas Fluorescens Lengt 8e-12
4f21_A246 Crystal Structure Of CarboxylesterasePHOSPHOLIPASE 2e-10
3cn7_A226 Crystal Structure Analysis Of The Carboxylesterase 4e-10
>pdb|1FJ2|A Chain A, Crystal Structure Of The Human Acyl Protein Thioesterase 1 At 1.5 A Resolution Length = 232 Back     alignment and structure

Iteration: 1

Score = 87.0 bits (214), Expect = 7e-18, Method: Compositional matrix adjust. Identities = 52/147 (35%), Positives = 77/147 (52%), Gaps = 17/147 (11%) Query: 26 VVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLPNIKWICPTAPTRPMTIFGGFPSTAW 85 +V K A V++LHGLGD G W++ + +IK+ICP AP RP+T+ +W Sbjct: 15 IVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSW 74 Query: 86 FDVGDLSEDVPDDLEGLDAAAAHVVNLLSTE-----PTDIKLGVGGFSMGAATALYSATC 140 FD+ LS D +D G+ AA ++ L+ E P++ ++ +GGFS G A +LY+A Sbjct: 75 FDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSN-RIILGGFSQGGALSLYTALT 133 Query: 141 FAHGKYGNGNPYPAKLSAVVGLSGWLP 167 KL+ V LS WLP Sbjct: 134 TQQ-----------KLAGVTALSCWLP 149
>pdb|3U0V|A Chain A, Crystal Structure Analysis Of Human Lyplal1 Length = 239 Back     alignment and structure
>pdb|1AUO|A Chain A, Carboxylesterase From Pseudomonas Fluorescens Length = 218 Back     alignment and structure
>pdb|4F21|A Chain A, Crystal Structure Of CarboxylesterasePHOSPHOLIPASE FAMILY PROTEIN From Francisella Tularensis Length = 246 Back     alignment and structure
>pdb|3CN7|A Chain A, Crystal Structure Analysis Of The Carboxylesterase Pa3859 From Pseudomonas Aeruginosa Pao1- Monoclinic Crystal Form Length = 226 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 1e-53
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 4e-53
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 3e-52
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 6e-50
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 2e-18
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 2e-16
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 3e-16
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 2e-15
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 1e-07
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 5e-07
1r3d_A 264 Conserved hypothetical protein VC1974; structural 7e-07
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 2e-06
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 2e-06
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 2e-05
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 5e-05
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 1e-04
3sty_A 267 Methylketone synthase 1; alpha/beta hydrolase, dec 2e-04
1m33_A 258 BIOH protein; alpha-betta-alpha sandwich, structur 2e-04
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 3e-04
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 3e-04
3dqz_A 258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 3e-04
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 4e-04
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 5e-04
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 6e-04
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 7e-04
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 7e-04
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 7e-04
3c6x_A 257 Hydroxynitrilase; atomic resolution, hydroxynitril 9e-04
2wfl_A 264 Polyneuridine-aldehyde esterase; alkaloid metaboli 9e-04
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Length = 226 Back     alignment and structure
 Score =  169 bits (431), Expect = 1e-53
 Identities = 40/151 (26%), Positives = 72/151 (47%), Gaps = 16/151 (10%)

Query: 26  VVRPKGKHQATVVWLHGLGDNGSSWSQLLETLP--LPNIKWICPTAPTRPMTIFGGFPST 83
           ++       A ++WLHGLG + + +  + E L   LP+ ++I P AP++ +T+ GG+   
Sbjct: 16  LILDAPNADACIIWLHGLGADRTDFKPVAEALQMVLPSTRFILPQAPSQAVTVNGGWVMP 75

Query: 84  AWFDVGDLSEDVPDDLEGLDAAAAHVVNLLSTEPTDI----KLGVGGFSMGAATALYSAT 139
           +W+D+   S     D + L+A+A  V+ L+  +        ++ + GFS G A  L++A 
Sbjct: 76  SWYDILAFSPARAIDEDQLNASADQVIALIDEQRAKGIAAERIILAGFSQGGAVVLHTA- 134

Query: 140 CFAHGKYGNGNPYPAKLSAVVGLSGWLPCSK 170
                       Y   L  V+ LS + P   
Sbjct: 135 ---------FRRYAQPLGGVLALSTYAPTFD 156


>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Length = 218 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Length = 232 Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Length = 239 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} Length = 209 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Length = 226 Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Length = 223 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Length = 251 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Length = 292 Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Length = 243 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Length = 264 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Length = 269 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Length = 238 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Length = 306 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Length = 245 Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Length = 315 Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Length = 267 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Length = 258 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Length = 273 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Length = 286 Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} Length = 258 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Length = 289 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Length = 271 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Length = 286 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Length = 398 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Length = 270 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Length = 316 Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Length = 257 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Length = 264 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
4f21_A246 Carboxylesterase/phospholipase family protein; str 99.82
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 99.79
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 99.79
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.77
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.77
2wfl_A 264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.74
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 99.73
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.72
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.71
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 99.71
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.7
3v48_A 268 Aminohydrolase, putative aminoacrylate hydrolase R 99.7
3c6x_A 257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.7
1ehy_A 294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.7
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.7
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 99.7
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 99.7
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 99.7
2xt0_A 297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.7
3sty_A 267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.69
2xua_A 266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.69
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.69
1b6g_A 310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.68
3dqz_A 258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.68
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.68
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 99.68
1r3d_A 264 Conserved hypothetical protein VC1974; structural 99.68
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.68
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 99.68
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.68
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.67
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.67
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.67
3bf7_A 255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.66
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.66
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 99.66
1wom_A 271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.66
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.66
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.65
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 99.64
1iup_A 282 META-cleavage product hydrolase; aromatic compound 99.64
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.64
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.63
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.63
2puj_A 286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.63
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.63
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.63
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 99.62
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.62
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.62
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.62
3pe6_A 303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.62
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.61
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 99.61
4dnp_A 269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.61
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 99.61
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.61
1mtz_A 293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.6
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.6
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 99.6
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 99.59
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 99.59
2r11_A 306 Carboxylesterase NP; 2632844, putative hydrolase, 99.59
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 99.59
3fla_A 267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.59
3qyj_A 291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.59
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 99.59
1m33_A 258 BIOH protein; alpha-betta-alpha sandwich, structur 99.58
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.58
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.58
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 99.58
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.58
2qvb_A 297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.57
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 99.57
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 99.56
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 99.56
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.56
1pja_A 302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.56
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 99.56
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 99.56
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 99.55
4g9e_A 279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.55
1mj5_A 302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.55
3hss_A 293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.55
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.54
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.54
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.54
2qmq_A 286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.54
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.53
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.53
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.53
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.52
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.52
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.52
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 99.52
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 99.51
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.5
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.5
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 99.25
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.5
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.5
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 99.49
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.48
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.47
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.47
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.47
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 99.47
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.47
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 99.45
3icv_A 316 Lipase B, CALB; circular permutation, cleavage on 99.45
3ils_A 265 PKS, aflatoxin biosynthesis polyketide synthase; A 99.45
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.44
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.44
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.44
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.43
1tca_A 317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 99.41
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 99.41
3tjm_A 283 Fatty acid synthase; thioesterase domain, fatty ac 99.41
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 99.41
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 99.4
3h04_A 275 Uncharacterized protein; protein with unknown func 99.4
1ex9_A 285 Lactonizing lipase; alpha-beta hydrolase fold, pho 99.4
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.39
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 99.39
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.38
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 99.38
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.38
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.38
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.38
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 99.38
3ksr_A 290 Putative serine hydrolase; catalytic triad, struct 99.37
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.37
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.37
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 99.37
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 99.37
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 99.37
2q0x_A 335 Protein DUF1749, uncharacterized protein; alpha/be 99.36
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 99.36
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 99.36
1kez_A300 Erythronolide synthase; polyketide synthase, modul 99.35
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 99.35
3fnb_A 405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 99.35
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 99.33
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 99.33
3tej_A329 Enterobactin synthase component F; nonribosomal pe 99.33
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.33
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 99.33
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 99.33
3bjr_A283 Putative carboxylesterase; structural genomics, jo 99.32
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 99.32
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 99.32
3lp5_A250 Putative cell surface hydrolase; structural genom 99.32
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 99.31
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 99.31
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 99.31
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 99.31
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.3
2x5x_A 342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 99.3
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 99.3
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 99.29
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 99.29
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 99.28
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 99.28
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.28
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 99.28
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 99.27
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 99.27
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 99.27
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 99.27
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 99.27
1ei9_A 279 Palmitoyl protein thioesterase 1; alpha/beta hydro 99.27
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 99.27
3ain_A323 303AA long hypothetical esterase; carboxylesterase 99.27
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 99.26
1sfr_A 304 Antigen 85-A; alpha/beta hydrolase, structural gen 99.26
4fle_A202 Esterase; structural genomics, PSI-biology, northe 99.25
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 99.22
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 99.21
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 99.21
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 99.2
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 99.2
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.2
3k2i_A 422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 99.19
3d59_A383 Platelet-activating factor acetylhydrolase; secret 99.18
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 99.17
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 99.16
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 99.15
3hlk_A 446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 99.15
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 99.15
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 99.14
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 99.14
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 99.12
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 99.1
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.09
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 99.09
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 99.08
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 99.08
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 99.04
2hih_A 431 Lipase 46 kDa form; A1 phospholipase, phospholipid 99.04
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 99.03
2dsn_A 387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 99.02
3nuz_A398 Putative acetyl xylan esterase; structural genomic 99.01
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.0
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.99
2px6_A 316 Thioesterase domain; thioesaterse domain, orlistat 98.99
3ebl_A 365 Gibberellin receptor GID1; alpha/beta hydrolase, l 98.97
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.97
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.96
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 98.93
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 98.9
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.89
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.86
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.86
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 98.85
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.84
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.84
4ezi_A 377 Uncharacterized protein; alpha-beta hydrolases fol 98.82
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 98.78
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 98.73
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 98.71
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 98.67
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 98.66
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 98.52
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 98.47
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 98.46
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 98.42
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 98.4
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 98.37
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 98.36
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 98.25
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 98.23
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 98.18
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 98.16
3gff_A 331 IROE-like serine hydrolase; NP_718593.1, structura 98.11
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 98.07
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 98.05
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 97.96
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 97.89
3guu_A 462 Lipase A; protein structure, hydrolase; HET: 1PE; 97.85
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 97.81
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 97.78
3hc7_A254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 97.68
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 97.67
1ivy_A 452 Human protective protein; carboxypeptidase, serine 97.64
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 97.42
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 97.25
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 97.24
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 97.21
4g4g_A 433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 97.13
3aja_A302 Putative uncharacterized protein; alpha-beta hydro 97.12
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 97.06
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 96.98
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 96.96
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 96.93
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 96.93
3pic_A 375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 96.86
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 96.71
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 96.53
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 96.34
3ngm_A 319 Extracellular lipase; secret lipase, hydrolase; 2. 96.3
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 96.29
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 96.27
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 96.23
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 96.18
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 96.18
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 96.18
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 96.17
1cpy_A 421 Serine carboxypeptidase; hydrolase (carboxypeptida 96.07
2czq_A205 Cutinase-like protein; alpha/beta hydrolase fold, 96.06
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 95.24
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 95.04
2ory_A 346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 93.68
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 91.52
2yij_A 419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 88.24
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
Probab=99.82  E-value=1.1e-20  Score=154.89  Aligned_cols=165  Identities=25%  Similarity=0.438  Sum_probs=113.1

Q ss_pred             CceeeeCCCCCCccEEEEEecCCCCchhhHHHHhhCC--CCCeEEEeeCCCCCCCcCCCCCcccccccCCCCCCC---CC
Q 028966           22 GRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLP--LPNIKWICPTAPTRPMTIFGGFPSTAWFDVGDLSED---VP   96 (201)
Q Consensus        22 ~~~~~~~~~~~~~~~vl~lHG~g~~~~~~~~~~~~l~--~~~~~vi~~d~p~~~~~~~~g~~~~~w~~~~~~~~~---~~   96 (201)
                      ....+++|.++++++||||||+|+++.+|..+++.+.  .+++.+++|++|..+.....+...++||+....+..   ..
T Consensus        25 l~y~ii~P~~~~~~~VI~LHG~G~~~~dl~~l~~~l~~~~~~~~~i~P~Ap~~~~~~~~~~~~~~Wf~~~~~~~~~~~~~  104 (246)
T 4f21_A           25 MNYELMEPAKQARFCVIWLHGLGADGHDFVDIVNYFDVSLDEIRFIFPHADIIPVTINMGMQMRAWYDIKSLDANSLNRV  104 (246)
T ss_dssp             CCEEEECCSSCCCEEEEEEEC--CCCCCGGGGGGGCCSCCTTEEEEEECGGGSCTTTHHHHHHHSCTTCCCC---CGGGG
T ss_pred             cCceEeCCCCcCCeEEEEEcCCCCCHHHHHHHHHHhhhcCCCeEEEeCCCCccccccCCCCCcccccccccccccchhhh
Confidence            3445678888889999999999999999999999885  358999999998765544444456789997754332   12


Q ss_pred             CchhHHHHHHHHHHHHHhcC----CCCCcEEEEEeChhHHHHHHHHHhhhcCCCCCCCCCCCCccEEEEecccCCCcchh
Q 028966           97 DDLEGLDAAAAHVVNLLSTE----PTDIKLGVGGFSMGAATALYSATCFAHGKYGNGNPYPAKLSAVVGLSGWLPCSKFD  172 (201)
Q Consensus        97 ~~~~~~~~~~~~l~~~i~~~----~~~~~~~LiG~S~Gg~~a~~~a~~~~~~~~~~~~~~p~~~~~li~~sg~~~~~~~~  172 (201)
                      .+.+.+.+.++.|.++++..    ...++++|+||||||++++.+++           .+|+.++++|.+||+++.....
T Consensus       105 ~d~~~i~~~~~~i~~li~~~~~~gi~~~ri~l~GfSqGg~~a~~~~~-----------~~~~~~a~~i~~sG~lp~~~~~  173 (246)
T 4f21_A          105 VDVEGINSSIAKVNKLIDSQVNQGIASENIILAGFSQGGIIATYTAI-----------TSQRKLGGIMALSTYLPAWDNF  173 (246)
T ss_dssp             SCCC-CHHHHHHHHHHHHHHHHC-CCGGGEEEEEETTTTHHHHHHHT-----------TCSSCCCEEEEESCCCTTHHHH
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHcCCChhcEEEEEeCchHHHHHHHHH-----------hCccccccceehhhccCccccc
Confidence            23345555566665555432    22369999999999999999994           7999999999999999876543


Q ss_pred             HHHHhhhhccccchhhhccceeeecCC
Q 028966          173 FIYLLQFERLSIIAFFNSTRHKSYSFP  199 (201)
Q Consensus       173 ~~~~~~~~~~~~~~~~~~~~~~~~~~~  199 (201)
                      ....  ......+++|..+...|-.+|
T Consensus       174 ~~~~--~~~~~~~Pvl~~HG~~D~vVp  198 (246)
T 4f21_A          174 KGKI--TSINKGLPILVCHGTDDQVLP  198 (246)
T ss_dssp             STTC--CGGGTTCCEEEEEETTCSSSC
T ss_pred             cccc--cccccCCchhhcccCCCCccC
Confidence            2211  112234566666655554443



>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 201
d1auoa_218 c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluor 2e-21
d1fj2a_229 c.69.1.14 (A:) Acyl protein thioesterase 1 {Human 4e-21
d1ufoa_238 c.69.1.27 (A:) Hypothetical protein TT1662 {Thermu 4e-09
d2r8ba1203 c.69.1.14 (A:44-246) Uncharacterized protein Atu24 3e-06
d2h1ia1202 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cer 2e-05
d3b5ea1209 c.69.1.14 (A:7-215) Uncharacterized protein Mll837 3e-05
d1r3da_264 c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio 0.001
d1pv1a_299 c.69.1.34 (A:) Hypothetical esterase YJL068C {Bake 0.002
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Length = 218 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carboxylesterase/thioesterase 1
domain: Carboxylesterase
species: Pseudomonas fluorescens [TaxId: 294]
 Score = 85.5 bits (210), Expect = 2e-21
 Identities = 45/171 (26%), Positives = 76/171 (44%), Gaps = 16/171 (9%)

Query: 26  VVRPKGKHQATVVWLHGLGDNGSSWSQLLETLP--LPNIKWICPTAPTRPMTIFGGFPST 83
           +++P     A V+WLHGLG +   +  + E L   L   +++ P APTRP+TI GG+   
Sbjct: 6   ILQPAKPADACVIWLHGLGADRYDFMPVAEALQESLLTTRFVLPQAPTRPVTINGGYEMP 65

Query: 84  AWFDVGDLSEDVPDDLEGLDAAAAHVVNLLS----TEPTDIKLGVGGFSMGAATALYSAT 139
           +W+D+  +S      LE L+ +A  V +L+     T     ++ + GFS G A   ++A 
Sbjct: 66  SWYDIKAMSPARSISLEELEVSAKMVTDLIEAQKRTGIDASRIFLAGFSQGGAVVFHTAF 125

Query: 140 CFAHGKYGNGNPYPAKLSAVVGLSGWLPCSKFDFIYLLQFERLSIIAFFNS 190
               G  G           V+ LS + P    +       +R+  +     
Sbjct: 126 INWQGPLGG----------VIALSTYAPTFGDELELSASQQRIPALCLHGQ 166


>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 229 Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Length = 238 Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Length = 203 Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Length = 202 Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Length = 209 Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Length = 264 Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 99.86
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 99.8
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.69
d1ehya_ 293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.68
d1c4xa_ 281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.67
d1brta_ 277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.66
d1pjaa_ 268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.66
d3c70a1 256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.66
d1hkha_ 279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.65
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.65
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.65
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.65
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.65
d1xkla_ 258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.65
d1a8qa_ 274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.64
d1r3da_ 264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.62
d1a88a_ 275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.61
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 99.61
d1j1ia_ 268 Meta cleavage compound hydrolase CarC {Janthinobac 99.61
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.6
d1mj5a_ 298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.6
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 99.59
d2rhwa1 283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.58
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 99.57
d1uk8a_ 271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.57
d1a8sa_ 273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.55
d1va4a_ 271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.54
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 99.53
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 99.53
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.51
d1m33a_ 256 Biotin biosynthesis protein BioH {Escherichia coli 99.5
d1xkta_ 286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 99.49
d1wm1a_ 313 Proline aminopeptidase {Serratia marcescens [TaxId 99.49
d1thta_ 302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.48
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.46
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 99.44
d1ex9a_ 285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 99.41
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.37
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.35
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 99.34
d1qo7a_ 394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 99.34
d1tcaa_ 317 Triacylglycerol lipase {Yeast (Candida antarctica) 99.33
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 99.33
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 99.22
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 99.22
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 99.2
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 99.18
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 99.13
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 99.12
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 99.11
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 99.03
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.03
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 99.01
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 99.01
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 98.93
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 98.9
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 98.9
d1ei9a_ 279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 98.83
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 98.8
d2pl5a1 362 Homoserine O-acetyltransferase {Leptospira interro 98.71
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 98.7
d2vata1 376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 98.7
d2b61a1 357 Homoserine O-acetyltransferase {Haemophilus influe 98.69
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 98.62
d1rp1a2 337 Pancreatic lipase, N-terminal domain {Dog (Canis f 98.6
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 98.58
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 98.53
d1mpxa2 381 Alpha-amino acid ester hydrolase {Xanthomonas citr 98.46
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 98.46
d1bu8a2 338 Pancreatic lipase, N-terminal domain {Rat (Rattus 98.46
d1ju3a2 347 Bacterial cocaine esterase N-terminal domain {Rhod 98.45
d1jkma_ 358 Carboxylesterase {Bacillus subtilis, brefeldin A e 98.45
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 98.45
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 98.36
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 98.32
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 98.27
d1qlwa_ 318 A novel bacterial esterase {Alcaligenes sp. [TaxId 98.21
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 98.13
d2b9va2 385 Alpha-amino acid ester hydrolase {Acetobacter past 98.05
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 98.02
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 97.98
d1ku0a_ 388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 97.98
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 97.96
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 97.95
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 97.8
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 97.74
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 97.67
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 97.66
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 97.58
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 97.49
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 96.98
d1lnsa3 405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 96.95
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 96.83
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 96.64
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 96.57
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 96.53
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 96.44
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 96.41
d1wpxa1 421 Serine carboxypeptidase II {Baker's yeast (Sacchar 96.1
g1wht.1 409 Serine carboxypeptidase II {Wheat (Triticum vulgar 95.8
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 94.8
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 94.79
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 94.35
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 94.25
d1ac5a_ 483 Serine carboxypeptidase II {Baker's yeast (Sacchar 92.15
g1gxs.1 425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 85.22
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carboxylesterase/thioesterase 1
domain: Acyl protein thioesterase 1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86  E-value=2e-21  Score=154.96  Aligned_cols=163  Identities=32%  Similarity=0.509  Sum_probs=120.9

Q ss_pred             ceeeeCCCCCCccEEEEEecCCCCchhhHHHHhhCCCCCeEEEeeCCCCCCCcCCCCCcccccccCCCCCCCCCCchhHH
Q 028966           23 RTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLETLPLPNIKWICPTAPTRPMTIFGGFPSTAWFDVGDLSEDVPDDLEGL  102 (201)
Q Consensus        23 ~~~~~~~~~~~~~~vl~lHG~g~~~~~~~~~~~~l~~~~~~vi~~d~p~~~~~~~~g~~~~~w~~~~~~~~~~~~~~~~~  102 (201)
                      .++++++.++++++||||||+|++.++|..++..+...++.+++|++|.......++...++||+....+.+...+...+
T Consensus        10 l~~~~p~~~~~~~~VI~lHG~G~~~~~~~~~~~~l~~~~~~~v~p~Ap~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~i   89 (229)
T d1fj2a_          10 LPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGI   89 (229)
T ss_dssp             CCEEECCSSCCSEEEEEECCSSSCHHHHHHHHHTTCCTTEEEEECCCCEEEEGGGTTEEEECSSCBCCCSTTCCBCHHHH
T ss_pred             CCcccCCCCCCCCEEEEEcCCCCCHHHHHHHHHHhcCCCCEEEeCCCCCCccccCCCcccccccccccccccchhhhHHH
Confidence            35777777778899999999999999999999999878999999999876544445556678999877666666677777


Q ss_pred             HHHHHHHHHHHhcC----CCCCcEEEEEeChhHHHHHHHHHhhhcCCCCCCCCCCCCccEEEEecccCCCcchhHHHHhh
Q 028966          103 DAAAAHVVNLLSTE----PTDIKLGVGGFSMGAATALYSATCFAHGKYGNGNPYPAKLSAVVGLSGWLPCSKFDFIYLLQ  178 (201)
Q Consensus       103 ~~~~~~l~~~i~~~----~~~~~~~LiG~S~Gg~~a~~~a~~~~~~~~~~~~~~p~~~~~li~~sg~~~~~~~~~~~~~~  178 (201)
                      .+.++.|..+++..    ...++++|+||||||++++.+++           .+|+.++++|.+||+++....+..... 
T Consensus        90 ~~~~~~l~~li~~~~~~~i~~~ri~l~GfS~Gg~~a~~~~~-----------~~~~~~~gvi~~sg~lp~~~~~~~~~~-  157 (229)
T d1fj2a_          90 KQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTAL-----------TTQQKLAGVTALSCWLPLRASFPQGPI-  157 (229)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCGGGEEEEEETHHHHHHHHHHT-----------TCSSCCSEEEEESCCCTTGGGSCSSCC-
T ss_pred             HHHHHHHHHHhhhhhhcCCCccceeeeecccchHHHHHHHH-----------hhccccCcccccccccccccccccccc-
Confidence            77777777666542    23369999999999999999994           799999999999999886544322110 


Q ss_pred             hhccccchhhhccceeeec
Q 028966          179 FERLSIIAFFNSTRHKSYS  197 (201)
Q Consensus       179 ~~~~~~~~~~~~~~~~~~~  197 (201)
                      ......+++++.+..+|-.
T Consensus       158 ~~~~~~~Pvli~hG~~D~~  176 (229)
T d1fj2a_         158 GGANRDISILQCHGDCDPL  176 (229)
T ss_dssp             CSTTTTCCEEEEEETTCSS
T ss_pred             ccccccCceeEEEcCCCCe
Confidence            1111234566655544433



>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure