Citrus Sinensis ID: 028968


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
MGSQVLPQALHWIPRSSTQCIPSKRLGFSTVLSRGPFVSHGVSVSAKPIGWNLGFFVNAQVKDSFVVRAEANEEAEANESIEEEQNEAVQAQGDVVVAVEAESEDKVEEEEVKAPRKPRVKLGDIMGILNKRAVEASESERPIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIGVEIVFPL
ccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccHHHcccccHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEcccEEcccEEEEEEEEccccccccEEEEEEEccEEEEEEccc
****VLPQALHWIPRSSTQCIPSKRLGFSTVLSR*********V********LG********DS***********************************************************DIMGILNKRAVEASESERPIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIGVEIVFPL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSQVLPQALHWIPRSSTQCIPSKRLGFSTVLSRGPFVSHGVSVSAKPIGWNLGFFVNAQVKDSFVxxxxxxxxxxxxxxxxxxxxxxxxxxxxVVVAVEAESEDKVEEEEVKAPRKPRVKLGDIMGILNKRAVEASESERPIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIGVEIVFPL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L19-1, chloroplastic Located at the 30S-50S ribosomal subunit interface and binds directly to 23S ribosomal RNA.probableQ8W463
50S ribosomal protein L19, chloroplastic Located at the 30S-50S ribosomal subunit interface and binds directly to 23S ribosomal RNA.probableP82413

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain R
Confidence level:very confident
Coverage over the Query: 124-177
View the alignment between query and template
View the model in PyMOL