Citrus Sinensis ID: 028971
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 201 | ||||||
| 221327589 | 250 | ascorbate peroxidase 2 [Citrus maxima] | 0.995 | 0.8 | 0.97 | 1e-104 | |
| 300837175 | 250 | ascorbate peroxidase [Citrus limon] | 0.995 | 0.8 | 0.96 | 4e-97 | |
| 37783265 | 250 | ascorbate peroxidase [Ipomoea batatas] | 0.980 | 0.788 | 0.842 | 9e-96 | |
| 559005 | 250 | ascorbate peroxidase [Nicotiana tabacum] | 0.980 | 0.788 | 0.822 | 2e-93 | |
| 6651272 | 250 | ascorbate peroxidase [Pimpinella brachyc | 0.980 | 0.788 | 0.827 | 4e-93 | |
| 194346220 | 250 | ascorbate peroxidase [Theobroma cacao] | 0.980 | 0.788 | 0.817 | 4e-93 | |
| 27449248 | 250 | ascorbate peroxidase [Hevea brasiliensis | 0.980 | 0.788 | 0.812 | 5e-93 | |
| 1389654 | 250 | cytosolic ascorbate peroxidase [Nicotian | 0.980 | 0.788 | 0.817 | 7e-93 | |
| 5257550 | 250 | cytosolic ascorbate peroxidase [Fragaria | 0.980 | 0.788 | 0.822 | 1e-92 | |
| 2754860 | 250 | cytosolic ascorbate peroxidase [Fragaria | 0.980 | 0.788 | 0.822 | 1e-92 |
| >gi|221327589|gb|ACM17464.1| ascorbate peroxidase 2 [Citrus maxima] | Back alignment and taxonomy information |
|---|
Score = 384 bits (985), Expect = e-104, Method: Compositional matrix adjust.
Identities = 194/200 (97%), Positives = 195/200 (97%)
Query: 1 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM 60
MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM
Sbjct: 1 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM 60
Query: 61 RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD 120
RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD
Sbjct: 61 RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD 120
Query: 121 DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT 180
DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct: 121 DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT 180
Query: 181 RNPLIFDNSYFTYVSLGALD 200
RNPLIFDNSYFT + G D
Sbjct: 181 RNPLIFDNSYFTELLTGEKD 200
|
Source: Citrus maxima Species: Citrus maxima Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|300837175|gb|ADK38619.1| ascorbate peroxidase [Citrus limon] | Back alignment and taxonomy information |
|---|
| >gi|37783265|gb|AAP42501.1| ascorbate peroxidase [Ipomoea batatas] | Back alignment and taxonomy information |
|---|
| >gi|559005|gb|AAA86689.1| ascorbate peroxidase [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|6651272|gb|AAF22246.1| ascorbate peroxidase [Pimpinella brachycarpa] | Back alignment and taxonomy information |
|---|
| >gi|194346220|gb|ABR68691.2| ascorbate peroxidase [Theobroma cacao] | Back alignment and taxonomy information |
|---|
| >gi|27449248|gb|AAO14118.1|AF457210_1 ascorbate peroxidase [Hevea brasiliensis] | Back alignment and taxonomy information |
|---|
| >gi|1389654|dbj|BAA12918.1| cytosolic ascorbate peroxidase [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|5257550|gb|AAD41404.1|AF159629_1 cytosolic ascorbate peroxidase [Fragaria x ananassa] gi|5257554|gb|AAD41406.1|AF159631_1 cytosolic ascorbate peroxidase [Fragaria x ananassa] gi|5442416|gb|AAD43337.1| cytosolic ascorbate peroxidase APX19 [Fragaria x ananassa] | Back alignment and taxonomy information |
|---|
| >gi|2754860|gb|AAB95222.1| cytosolic ascorbate peroxidase [Fragaria x ananassa] gi|5442414|gb|AAD43336.1| cytosolic ascorbate peroxidase [Fragaria x ananassa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 201 | ||||||
| TAIR|locus:2026616 | 250 | APX1 "ascorbate peroxidase 1" | 0.950 | 0.764 | 0.801 | 3e-85 | |
| TAIR|locus:2074914 | 251 | APX2 "ascorbate peroxidase 2" | 0.965 | 0.772 | 0.769 | 3.2e-81 | |
| TAIR|locus:2131586 | 287 | APX3 "ascorbate peroxidase 3" | 0.950 | 0.665 | 0.651 | 2e-63 | |
| TAIR|locus:2125409 | 279 | APX5 "ascorbate peroxidase 5" | 0.935 | 0.673 | 0.589 | 4.2e-56 | |
| ASPGD|ASPL0000044163 | 361 | ccp1 [Emericella nidulans (tax | 0.940 | 0.523 | 0.461 | 3.9e-44 | |
| ASPGD|ASPL0000029968 | 312 | AN5440 [Emericella nidulans (t | 0.791 | 0.509 | 0.536 | 1.2e-42 | |
| UNIPROTKB|A4QVH4 | 362 | CCP1 "Cytochrome c peroxidase, | 0.910 | 0.505 | 0.468 | 6.6e-42 | |
| UNIPROTKB|A4R606 | 300 | MGG_10368 "Putative heme-bindi | 0.835 | 0.56 | 0.525 | 1.4e-41 | |
| TAIR|locus:2204735 | 426 | TAPX "thylakoidal ascorbate pe | 0.800 | 0.377 | 0.479 | 2.1e-36 | |
| CGD|CAL0000335 | 291 | orf19.584 [Candida albicans (t | 0.890 | 0.615 | 0.443 | 3.5e-36 |
| TAIR|locus:2026616 APX1 "ascorbate peroxidase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 853 (305.3 bits), Expect = 3.0e-85, P = 3.0e-85
Identities = 153/191 (80%), Positives = 172/191 (90%)
Query: 1 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM 60
MTKNYPTVSEDYKKAVEKC+RKLRG IAEKNCAP+M+R+AWHSAGT+D +++TGGPFGTM
Sbjct: 1 MTKNYPTVSEDYKKAVEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTM 60
Query: 61 RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD 120
R AEQAH AN+G+ IA+RLL+P +EQFPTIS+AD +QLAGVV VEVTGGPDIPFHPGR+
Sbjct: 61 RFDAEQAHGANSGIHIALRLLDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGRE 120
Query: 121 DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT 180
DK +PP EGRLPDA +G DHLR VF QMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct: 121 DKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT 180
Query: 181 RNPLIFDNSYF 191
NPLIFDNSYF
Sbjct: 181 SNPLIFDNSYF 191
|
|
| TAIR|locus:2074914 APX2 "ascorbate peroxidase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2131586 APX3 "ascorbate peroxidase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2125409 APX5 "ascorbate peroxidase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000044163 ccp1 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000029968 AN5440 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4QVH4 CCP1 "Cytochrome c peroxidase, mitochondrial" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4R606 MGG_10368 "Putative heme-binding peroxidase" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2204735 TAPX "thylakoidal ascorbate peroxidase" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0000335 orf19.584 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 201 | |||
| PLN02364 | 250 | PLN02364, PLN02364, L-ascorbate peroxidase 1 | 1e-119 | |
| cd00691 | 253 | cd00691, ascorbate_peroxidase, Ascorbate peroxidas | 1e-117 | |
| PLN02879 | 251 | PLN02879, PLN02879, L-ascorbate peroxidase | 1e-111 | |
| PLN02608 | 289 | PLN02608, PLN02608, L-ascorbate peroxidase | 1e-109 | |
| cd00314 | 255 | cd00314, plant_peroxidase_like, Heme-dependent per | 9e-44 | |
| pfam00141 | 180 | pfam00141, peroxidase, Peroxidase | 5e-43 | |
| COG0376 | 730 | COG0376, KatG, Catalase (peroxidase I) [Inorganic | 2e-31 | |
| cd00649 | 409 | cd00649, catalase_peroxidase_1, N-terminal catalyt | 3e-22 | |
| TIGR00198 | 716 | TIGR00198, cat_per_HPI, catalase/peroxidase HPI | 1e-19 | |
| PRK15061 | 726 | PRK15061, PRK15061, catalase/hydroperoxidase HPI(I | 9e-18 | |
| cd08201 | 264 | cd08201, plant_peroxidase_like_1, Uncharacterized | 2e-16 | |
| cd00692 | 328 | cd00692, ligninase, Ligninase and other manganese- | 1e-13 | |
| cd00693 | 298 | cd00693, secretory_peroxidase, Horseradish peroxid | 3e-10 | |
| COG0376 | 730 | COG0376, KatG, Catalase (peroxidase I) [Inorganic | 4e-06 | |
| cd08200 | 297 | cd08200, catalase_peroxidase_2, C-terminal non-cat | 6e-06 | |
| PLN03030 | 324 | PLN03030, PLN03030, cationic peroxidase; Provision | 3e-05 | |
| PRK15061 | 726 | PRK15061, PRK15061, catalase/hydroperoxidase HPI(I | 6e-05 | |
| TIGR00198 | 716 | TIGR00198, cat_per_HPI, catalase/peroxidase HPI | 5e-04 |
| >gnl|CDD|166005 PLN02364, PLN02364, L-ascorbate peroxidase 1 | Back alignment and domain information |
|---|
Score = 337 bits (864), Expect = e-119
Identities = 153/191 (80%), Positives = 172/191 (90%)
Query: 1 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM 60
MTKNYPTVSEDYKKAVEKC+RKLRG IAEKNCAP+M+R+AWHSAGT+D +++TGGPFGTM
Sbjct: 1 MTKNYPTVSEDYKKAVEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTM 60
Query: 61 RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD 120
R AEQAH AN+G+ IA+RLL+P +EQFPTIS+AD +QLAGVV VEVTGGPDIPFHPGR+
Sbjct: 61 RFDAEQAHGANSGIHIALRLLDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGRE 120
Query: 121 DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT 180
DK +PP EGRLPDA +G DHLR VF QMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct: 121 DKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT 180
Query: 181 RNPLIFDNSYF 191
NPLIFDNSYF
Sbjct: 181 SNPLIFDNSYF 191
|
Length = 250 |
| >gnl|CDD|173825 cd00691, ascorbate_peroxidase, Ascorbate peroxidases and cytochrome C peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|178467 PLN02879, PLN02879, L-ascorbate peroxidase | Back alignment and domain information |
|---|
| >gnl|CDD|178218 PLN02608, PLN02608, L-ascorbate peroxidase | Back alignment and domain information |
|---|
| >gnl|CDD|173823 cd00314, plant_peroxidase_like, Heme-dependent peroxidases similar to plant peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|215745 pfam00141, peroxidase, Peroxidase | Back alignment and domain information |
|---|
| >gnl|CDD|223453 COG0376, KatG, Catalase (peroxidase I) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|173824 cd00649, catalase_peroxidase_1, N-terminal catalytic domain of catalase-peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|232870 TIGR00198, cat_per_HPI, catalase/peroxidase HPI | Back alignment and domain information |
|---|
| >gnl|CDD|237891 PRK15061, PRK15061, catalase/hydroperoxidase HPI(I); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173829 cd08201, plant_peroxidase_like_1, Uncharacterized family of plant peroxidase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173826 cd00692, ligninase, Ligninase and other manganese-dependent fungal peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|173827 cd00693, secretory_peroxidase, Horseradish peroxidase and related secretory plant peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|223453 COG0376, KatG, Catalase (peroxidase I) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|173828 cd08200, catalase_peroxidase_2, C-terminal non-catalytic domain of catalase-peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|215545 PLN03030, PLN03030, cationic peroxidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237891 PRK15061, PRK15061, catalase/hydroperoxidase HPI(I); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|232870 TIGR00198, cat_per_HPI, catalase/peroxidase HPI | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 201 | |||
| PLN02364 | 250 | L-ascorbate peroxidase 1 | 100.0 | |
| PLN02879 | 251 | L-ascorbate peroxidase | 100.0 | |
| PLN02608 | 289 | L-ascorbate peroxidase | 100.0 | |
| cd00691 | 253 | ascorbate_peroxidase Ascorbate peroxidases and cyt | 100.0 | |
| PLN03030 | 324 | cationic peroxidase; Provisional | 100.0 | |
| cd00693 | 298 | secretory_peroxidase Horseradish peroxidase and re | 100.0 | |
| PF00141 | 230 | peroxidase: Peroxidase; InterPro: IPR002016 Peroxi | 100.0 | |
| cd00692 | 328 | ligninase Ligninase and other manganese-dependent | 100.0 | |
| cd00314 | 255 | plant_peroxidase_like Heme-dependent peroxidases s | 100.0 | |
| cd08201 | 264 | plant_peroxidase_like_1 Uncharacterized family of | 100.0 | |
| cd00649 | 409 | catalase_peroxidase_1 N-terminal catalytic domain | 100.0 | |
| TIGR00198 | 716 | cat_per_HPI catalase/peroxidase HPI. Note that the | 100.0 | |
| PRK15061 | 726 | catalase/hydroperoxidase HPI(I); Provisional | 100.0 | |
| cd08200 | 297 | catalase_peroxidase_2 C-terminal non-catalytic dom | 100.0 | |
| TIGR00198 | 716 | cat_per_HPI catalase/peroxidase HPI. Note that the | 100.0 | |
| PRK15061 | 726 | catalase/hydroperoxidase HPI(I); Provisional | 100.0 | |
| COG0376 | 730 | KatG Catalase (peroxidase I) [Inorganic ion transp | 99.97 | |
| COG0376 | 730 | KatG Catalase (peroxidase I) [Inorganic ion transp | 99.72 |
| >PLN02364 L-ascorbate peroxidase 1 | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.8e-63 Score=423.17 Aligned_cols=196 Identities=79% Similarity=1.337 Sum_probs=190.7
Q ss_pred CCCCCCChhHHHHHHHHHHHHHHhhHhhcCCchHHHHHHHhhhcCccccCCCCCCCCccccChHHhhccccCchHHHHHH
Q 028971 1 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRL 80 (201)
Q Consensus 1 ~~~~cp~~~~~v~~~v~~~~~~i~~~~~~~~~a~~~lRl~FHDc~~~d~~~~~gG~dgSi~~~~e~~~~~N~gl~~~~~~ 80 (201)
|++.||.+.+.+++++++++++|++++.++.++|.+|||+||||++||...+.|||||||.+++|+++++|.+|.+++++
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~lRl~FHd~~t~dc~~~~GG~dgSi~~~~E~~~~~N~gl~~~~~~ 80 (250)
T PLN02364 1 MTKNYPTVSEDYKKAVEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTMRFDAEQAHGANSGIHIALRL 80 (250)
T ss_pred CCCCCCCccHHHHHHHHHHHHHHHHHHhCCCcHHHHHHHHHccccCcCcCCCCCCCCccccccccccCCCccCHHHHHHH
Confidence 89999999999999999999999999999999999999999999999999888999999999999999999999889999
Q ss_pred HHHhHHhCCCCCHHHHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHh-cCCCcccceee
Q 028971 81 LEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQ-MGLSDKDIVAL 159 (201)
Q Consensus 81 i~~iK~~~~~VS~ADiialaa~~av~~~GGP~~~v~~GR~D~~~s~~~~~lP~p~~~~~~l~~~F~~~-~Gl~~~e~VaL 159 (201)
|+.||+++++|||||||+||||+||+++|||.|+|++||+|+.+++++++||.|+.++++|++.| ++ +||+++|||||
T Consensus 81 i~~ik~~~~~VScADilalAardAV~~~GGP~~~v~~GR~D~~~s~~~~~lP~p~~~~~~l~~~F-~~~~Gl~~~d~VaL 159 (250)
T PLN02364 81 LDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGREDKPQPPPEGRLPDATKGCDHLRDVF-AKQMGLSDKDIVAL 159 (250)
T ss_pred HHHHHHHcCCcCHHHHHHHHHHHHHHhcCCCeeCCCCCCCCcccccccCCCCCCCcCHHHHHHHH-HHhcCCCHHHheee
Confidence 99999999999999999999999999999999999999999999998889999999999999999 76 69999999999
Q ss_pred ecccccCcccCCCCCCCCCCCCCCCcccHHHHHHHhhC
Q 028971 160 SGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTYVSLG 197 (201)
Q Consensus 160 ~GaHtiG~~~~~~~~~~g~~~~tp~~fDn~yy~~l~~~ 197 (201)
+||||||.+||.|+++.|+|+.||.+|||+||++|+.+
T Consensus 160 sGaHTiG~~hc~r~~~~g~~~~tp~~fDn~Yy~~ll~~ 197 (250)
T PLN02364 160 SGAHTLGRCHKDRSGFEGAWTSNPLIFDNSYFKELLSG 197 (250)
T ss_pred ecceeeccccCCCCCCCCCCCCCCCccchHHHHHHhcC
Confidence 99999999999999998999999999999999999987
|
|
| >PLN02879 L-ascorbate peroxidase | Back alignment and domain information |
|---|
| >PLN02608 L-ascorbate peroxidase | Back alignment and domain information |
|---|
| >cd00691 ascorbate_peroxidase Ascorbate peroxidases and cytochrome C peroxidases | Back alignment and domain information |
|---|
| >PLN03030 cationic peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd00693 secretory_peroxidase Horseradish peroxidase and related secretory plant peroxidases | Back alignment and domain information |
|---|
| >PF00141 peroxidase: Peroxidase; InterPro: IPR002016 Peroxidases are haem-containing enzymes that use hydrogen peroxide as the electron acceptor to catalyse a number of oxidative reactions | Back alignment and domain information |
|---|
| >cd00692 ligninase Ligninase and other manganese-dependent fungal peroxidases | Back alignment and domain information |
|---|
| >cd00314 plant_peroxidase_like Heme-dependent peroxidases similar to plant peroxidases | Back alignment and domain information |
|---|
| >cd08201 plant_peroxidase_like_1 Uncharacterized family of plant peroxidase-like proteins | Back alignment and domain information |
|---|
| >cd00649 catalase_peroxidase_1 N-terminal catalytic domain of catalase-peroxidases | Back alignment and domain information |
|---|
| >TIGR00198 cat_per_HPI catalase/peroxidase HPI | Back alignment and domain information |
|---|
| >PRK15061 catalase/hydroperoxidase HPI(I); Provisional | Back alignment and domain information |
|---|
| >cd08200 catalase_peroxidase_2 C-terminal non-catalytic domain of catalase-peroxidases | Back alignment and domain information |
|---|
| >TIGR00198 cat_per_HPI catalase/peroxidase HPI | Back alignment and domain information |
|---|
| >PRK15061 catalase/hydroperoxidase HPI(I); Provisional | Back alignment and domain information |
|---|
| >COG0376 KatG Catalase (peroxidase I) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0376 KatG Catalase (peroxidase I) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 201 | ||||
| 1apx_A | 249 | Crystal Structure Of Recombinant Ascorbate Peroxida | 1e-91 | ||
| 1oaf_A | 261 | Ascobate Peroxidase From Soybean Cytosol In Complex | 6e-90 | ||
| 2vcf_X | 264 | Structure Of Isoniazid (Inh) Bound To Cytosolic Soy | 7e-90 | ||
| 2xif_A | 249 | The Structure Of Ascorbate Peroxidase Compound Ii L | 7e-90 | ||
| 2y6b_A | 249 | Ascorbate Peroxidase R38k Mutant Length = 249 | 2e-89 | ||
| 2cl4_X | 261 | Ascorbate Peroxidase R172a Mutant Length = 261 | 4e-89 | ||
| 2y6a_A | 249 | Ascorbate Peroxidase R38a Mutant Length = 249 | 4e-89 | ||
| 2vcs_A | 261 | Structure Of Isoniazid (Inh) Bound To Cytosolic Soy | 6e-89 | ||
| 2ggn_X | 261 | Conformational Mobility In The Active Site Of A Hem | 1e-88 | ||
| 3zcy_A | 249 | Ascorbate Peroxidase W41a-h42y Mutant Length = 249 | 5e-88 | ||
| 3zch_A | 261 | Ascorbate Peroxidase W41a-h42m Mutant Length = 261 | 1e-87 | ||
| 3zcg_A | 261 | Ascorbate Peroxidase W41a-h42c Mutant Length = 261 | 2e-87 | ||
| 1jci_A | 294 | Stabilization Of The Engineered Cation-Binding Loop | 1e-38 | ||
| 1stq_A | 294 | Cyrstal Structure Of Cytochrome C Peroxidase Mutant | 3e-38 | ||
| 1jdr_A | 294 | Crystal Structure Of A Proximal Domain Potassium Bi | 1e-37 | ||
| 1sog_A | 294 | Cyrstal Structure Of Cytochrome C Peroxidase Mutant | 1e-37 | ||
| 1iyn_A | 295 | Crystal Structure Of Chloroplastic Ascorbate Peroxi | 2e-37 | ||
| 3riv_A | 271 | The Crystal Structure Of Leishmania Major Peroxidas | 9e-37 | ||
| 4ged_A | 268 | Crystal Structure Of The Leishmania Major Peroxidas | 1e-36 | ||
| 1krj_A | 294 | Engineering Calcium-Binding Site Into Cytochrome C | 3e-36 | ||
| 3e2n_A | 287 | Engineering Ascorbate Peroxidase Activity Into Cyto | 3e-36 | ||
| 3riw_A | 271 | The Crystal Structure Of Leishmania Major Peroxidas | 1e-35 | ||
| 4a71_A | 296 | Cytochrome C Peroxidase In Complex With Phenol Leng | 9e-35 | ||
| 3m23_A | 291 | Crystallographic And Single Crystal Spectral Analys | 1e-34 | ||
| 3e2o_A | 294 | Crystal Structure Of Cytochrome C Peroxidase, N184r | 2e-34 | ||
| 2v23_A | 296 | Structure Of Cytochrome C Peroxidase Mutant N184r Y | 3e-34 | ||
| 2v2e_A | 294 | Structure Of Isoniazid (Inh) Bound To Cytochrome C | 3e-34 | ||
| 4a78_A | 296 | Cytochrome C Peroxidase M119w In Complex With Guiac | 6e-34 | ||
| 2xj5_A | 294 | The Structure Of Cytochrome C Peroxidase Compound I | 6e-34 | ||
| 3r98_A | 293 | Joint Neutron And X-Ray Structure Of Cytochrome C P | 7e-34 | ||
| 1kok_A | 294 | Crystal Structure Of Mesopone Cytochrome C Peroxida | 7e-34 | ||
| 1ebe_A | 294 | Laue Diffraction Study On The Structure Of Cytochro | 7e-34 | ||
| 1s6v_A | 294 | Structure Of A Cytochrome C Peroxidase-Cytochrome C | 1e-33 | ||
| 4a7m_A | 296 | Cytochrome C Peroxidase S81w Mutant Length = 296 | 2e-33 | ||
| 2xil_A | 294 | The Structure Of Cytochrome C Peroxidase Compound I | 2e-33 | ||
| 2x07_A | 293 | Cytochrome C Peroxidase: Engineered Ascorbate Bindi | 2e-33 | ||
| 1mk8_A | 294 | Crystal Structure Of A Mutant Cytochrome C Peroxida | 3e-33 | ||
| 1cck_A | 291 | Altering Substrate Specificity Of Cytochrome C Pero | 5e-33 | ||
| 1bek_A | 291 | Effect Of Unnatural Heme Substitution On Kinetics O | 1e-32 | ||
| 1a2f_A | 291 | Probing The Strength And Character Of An Asp-His-X | 1e-32 | ||
| 2ccp_A | 296 | X-Ray Structures Of Recombinant Yeast Cytochrome C | 1e-32 | ||
| 1ccc_A | 297 | The Asp-His-Fe Triad Of Cytochrome C Peroxidase Con | 1e-32 | ||
| 1cyf_A | 296 | Identifying The Physiological Electron Transfer Sit | 1e-32 | ||
| 2pcb_A | 296 | Crystal Structure Of A Complex Between Electron Tra | 1e-32 | ||
| 2cep_A | 296 | Role Of Met-230 In Intramolecular Electron Transfer | 1e-32 | ||
| 1ccb_A | 297 | The Asp-His-Fe Triad Of Cytochrome C Peroxidase Con | 1e-32 | ||
| 1cca_A | 297 | The Asp-His-Fe Triad Of Cytochrome C Peroxidase Con | 1e-32 | ||
| 1a2g_A | 291 | Probing The Strength And Character Of An Asp-His-X | 1e-32 | ||
| 1bep_A | 291 | Effect Of Unnatural Heme Substitution On Kinetics O | 2e-32 | ||
| 2gb8_A | 294 | Solution Structure Of The Complex Between Yeast Iso | 2e-32 | ||
| 6ccp_A | 296 | Effect Of Arginine-48 Replacement On The Reaction B | 3e-32 | ||
| 1ccl_A | 291 | Probing The Strength And Character Of An Asp-His-X | 4e-32 | ||
| 4ccx_A | 294 | Altering Substrate Specificity At The Heme Edge Of | 5e-32 | ||
| 3ccx_A | 294 | Altering Substrate Specificity At The Heme Edge Of | 6e-32 | ||
| 1cci_A | 294 | How Flexible Are Proteins? Trapping Of A Flexible L | 6e-32 | ||
| 1dj1_A | 291 | Crystal Structure Of R48a Mutant Of Cytochrome C Pe | 1e-31 | ||
| 7ccp_A | 296 | Effect Of Arginine-48 Replacement On The Reaction B | 1e-31 | ||
| 1beq_A | 291 | Interaction Between Proximal And Distals Regions Of | 2e-31 | ||
| 4ccp_A | 296 | X-Ray Structures Of Recombinant Yeast Cytochrome C | 2e-31 | ||
| 1dcc_A | 296 | 2.2 Angstrom Structure Of Oxyperoxidase: A Model Fo | 2e-31 | ||
| 5ccp_A | 296 | Histidine 52 Is A Critical Residue For Rapid Format | 2e-31 | ||
| 1cce_A | 291 | Construction Of A Bis-Aquo Heme Enzyme And Replacem | 2e-31 | ||
| 2ia8_A | 291 | Kinetic And Crystallographic Studies Of A Redesigne | 2e-31 | ||
| 1ds4_A | 292 | Cytochrome C Peroxidase H175g Mutant, Imidazole Com | 3e-31 | ||
| 1bva_A | 294 | Manganese Binding Mutant In Cytochrome C Peroxidase | 3e-31 | ||
| 1cpg_A | 296 | A Cation Binding Motif Stabilizes The Compound I Ra | 5e-31 | ||
| 1bem_A | 291 | Interaction Between Proximal And Distals Regions Of | 6e-31 | ||
| 1dse_A | 292 | Cytochrome C Peroxidase H175g Mutant, Imidazole Com | 6e-31 | ||
| 1cmu_A | 294 | The Role Of Aspartate-235 In The Binding Of Cations | 7e-31 | ||
| 1cpd_A | 296 | A Cation Binding Motif Stabilizes The Compound I Ra | 7e-31 | ||
| 2aqd_A | 294 | Cytochrome C Peroxidase (Ccp) In Complex With 2,5- | 7e-31 | ||
| 2rbu_X | 292 | Cytochrome C Peroxidase In Complex With Cyclopentan | 7e-31 | ||
| 2anz_A | 294 | Cytochrome C Peroxidase In Complex With 2,6-Diamino | 7e-31 | ||
| 1bej_A | 291 | Interaction Between Proximal And Distals Regions Of | 8e-31 | ||
| 3exb_A | 295 | Crystal Structure Of Cytochrome C Peroxidase With A | 4e-30 | ||
| 1kxn_A | 289 | Crystal Structure Of Cytochrome C Peroxidase With A | 4e-30 | ||
| 1kxm_A | 290 | Crystal Structure Of Cytochrome C Peroxidase With A | 4e-30 | ||
| 1ub2_A | 720 | Crystal Structure Of Catalase-Peroxidase From Synec | 2e-15 | ||
| 1mn1_A | 357 | Manganese Peroxidase Substrate Binding Site Mutant | 1e-13 | ||
| 1mn2_A | 357 | Manganese Peroxidase Substrate Binding Site Mutant | 2e-13 | ||
| 1yyd_A | 357 | High Resolution Crystal Structure Of Manganese Pero | 3e-13 | ||
| 1itk_A | 731 | Crystal Structure Of Catalase-peroxidase From Haloa | 6e-12 | ||
| 3vlh_A | 737 | Crystal Structure Analysis Of The Arg409leu Variant | 6e-12 | ||
| 3uw8_A | 737 | Crystal Structure Analysis Of The Ser305thr Variant | 1e-11 | ||
| 3vlk_A | 737 | Crystal Structure Analysis Of The Ser305ala Variant | 1e-11 | ||
| 2dv1_A | 748 | Crystal Structure Of D141e Mutant Of Bpkatg Length | 2e-11 | ||
| 1mwv_A | 714 | Crystal Structure Of Catalase-peroxidase Katg Of Bu | 2e-11 | ||
| 3n3s_A | 748 | Crystal Structure Of The E198a Variant Of Burkholde | 2e-11 | ||
| 1x7u_A | 748 | Crystal Structure Of The S324t Of Catalase-Peroxida | 2e-11 | ||
| 3n3q_A | 748 | Crystal Structure Of The S324t Variant Of Burkholde | 2e-11 | ||
| 2fxg_A | 748 | Crystal Structure Of Katg At Ph 4.5 Length = 748 | 2e-11 | ||
| 3vlm_A | 737 | Crystal Structure Analysis Of The Met244ala Variant | 4e-11 | ||
| 2dv2_A | 748 | Crystal Structure Of D141e Mutant Of Bpkatg At Ph 8 | 7e-10 | ||
| 3rrw_A | 268 | Crystal Structure Of The Tl29 Protein From Arabidop | 8e-10 | ||
| 3n3r_A | 748 | Crystal Structure Of The E198a Variant Of Catalase- | 8e-10 | ||
| 2fxj_A | 748 | Crystal Structure Of Katg At Ph 8.5 Length = 748 | 9e-10 | ||
| 3fm6_A | 331 | Crystal Structure Analysis Of Fungal Versatile Pero | 3e-09 | ||
| 4fef_A | 315 | The Crystal Structures Of Several Mutants Of Pleuro | 6e-09 | ||
| 3q3u_A | 338 | Trametes Cervina Lignin Peroxidase Length = 338 | 1e-08 | ||
| 4a5g_A | 308 | Raphanus Sativus Anionic Peroxidase. Length = 308 | 3e-07 | ||
| 2ccd_A | 740 | Crystal Structure Of The Catalase-Peroxidase (Katg) | 8e-07 | ||
| 2cca_A | 740 | Crystal Structure Of The Catalase-Peroxidase (Katg) | 8e-07 | ||
| 1sj2_A | 743 | Crystal Structure Of Mycobacterium Tuberculosis Cat | 8e-07 | ||
| 3ut2_A | 764 | Crystal Structure Of Fungal Magkatg2 Length = 764 | 1e-06 | ||
| 1b80_A | 351 | Rec. Lignin Peroxidase H8 Oxidatively Processed Len | 1e-05 | ||
| 1b85_A | 351 | Lignin Peroxidase Length = 351 | 2e-05 | ||
| 1b82_A | 351 | Pristine Recomb. Lignin Peroxidase H8 Length = 351 | 2e-05 | ||
| 1fhf_A | 304 | The Structure Of Soybean Peroxidase Length = 304 | 3e-05 | ||
| 1u2j_A | 326 | Crystal Structure Of The C-Terminal Domain From The | 5e-05 | ||
| 1u2k_A | 309 | Crystal Structure Of The C-Terminal Domain From The | 5e-05 | ||
| 1pa2_A | 306 | Arabidopsis Thaliana Peroxidase A2 Length = 306 | 1e-04 |
| >pdb|1APX|A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase Length = 249 | Back alignment and structure |
|
| >pdb|1OAF|A Chain A, Ascobate Peroxidase From Soybean Cytosol In Complex With Ascorbate Length = 261 | Back alignment and structure |
| >pdb|2VCF|X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase Length = 264 | Back alignment and structure |
| >pdb|2XIF|A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii Length = 249 | Back alignment and structure |
| >pdb|2Y6B|A Chain A, Ascorbate Peroxidase R38k Mutant Length = 249 | Back alignment and structure |
| >pdb|2CL4|X Chain X, Ascorbate Peroxidase R172a Mutant Length = 261 | Back alignment and structure |
| >pdb|2Y6A|A Chain A, Ascorbate Peroxidase R38a Mutant Length = 249 | Back alignment and structure |
| >pdb|2VCS|A Chain A, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase Mutant H42a Length = 261 | Back alignment and structure |
| >pdb|2GGN|X Chain X, Conformational Mobility In The Active Site Of A Heme Peroxidase Length = 261 | Back alignment and structure |
| >pdb|3ZCY|A Chain A, Ascorbate Peroxidase W41a-h42y Mutant Length = 249 | Back alignment and structure |
| >pdb|3ZCH|A Chain A, Ascorbate Peroxidase W41a-h42m Mutant Length = 261 | Back alignment and structure |
| >pdb|3ZCG|A Chain A, Ascorbate Peroxidase W41a-h42c Mutant Length = 261 | Back alignment and structure |
| >pdb|1JCI|A Chain A, Stabilization Of The Engineered Cation-Binding Loop In Cytochrome C Peroxidase (Ccp) Length = 294 | Back alignment and structure |
| >pdb|1STQ|A Chain A, Cyrstal Structure Of Cytochrome C Peroxidase Mutant: Ccpk2m3 Length = 294 | Back alignment and structure |
| >pdb|1JDR|A Chain A, Crystal Structure Of A Proximal Domain Potassium Binding Variant Of Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|1SOG|A Chain A, Cyrstal Structure Of Cytochrome C Peroxidase Mutant: Ccpk2m2 Length = 294 | Back alignment and structure |
| >pdb|1IYN|A Chain A, Crystal Structure Of Chloroplastic Ascorbate Peroxidase From Tobacco Plants And Structural Insights For Its Instability Length = 295 | Back alignment and structure |
| >pdb|3RIV|A Chain A, The Crystal Structure Of Leishmania Major Peroxidase Length = 271 | Back alignment and structure |
| >pdb|4GED|A Chain A, Crystal Structure Of The Leishmania Major Peroxidase-Cytochrome C Complex Length = 268 | Back alignment and structure |
| >pdb|1KRJ|A Chain A, Engineering Calcium-Binding Site Into Cytochrome C Peroxidase (Ccp) Length = 294 | Back alignment and structure |
| >pdb|3E2N|A Chain A, Engineering Ascorbate Peroxidase Activity Into Cytochrome C Peroxidase Length = 287 | Back alignment and structure |
| >pdb|3RIW|A Chain A, The Crystal Structure Of Leishmania Major Peroxidase Mutant C197t Length = 271 | Back alignment and structure |
| >pdb|4A71|A Chain A, Cytochrome C Peroxidase In Complex With Phenol Length = 296 | Back alignment and structure |
| >pdb|3M23|A Chain A, Crystallographic And Single Crystal Spectral Analysis Of The Peroxidase Ferryl Intermediate Length = 291 | Back alignment and structure |
| >pdb|3E2O|A Chain A, Crystal Structure Of Cytochrome C Peroxidase, N184r Mutant Length = 294 | Back alignment and structure |
| >pdb|2V23|A Chain A, Structure Of Cytochrome C Peroxidase Mutant N184r Y36a Length = 296 | Back alignment and structure |
| >pdb|2V2E|A Chain A, Structure Of Isoniazid (Inh) Bound To Cytochrome C Peroxidase Mutant N184r Y36a Length = 294 | Back alignment and structure |
| >pdb|4A78|A Chain A, Cytochrome C Peroxidase M119w In Complex With Guiacol Length = 296 | Back alignment and structure |
| >pdb|2XJ5|A Chain A, The Structure Of Cytochrome C Peroxidase Compound Ii Length = 294 | Back alignment and structure |
| >pdb|3R98|A Chain A, Joint Neutron And X-Ray Structure Of Cytochrome C Peroxidase Length = 293 | Back alignment and structure |
| >pdb|1KOK|A Chain A, Crystal Structure Of Mesopone Cytochrome C Peroxidase (Mpccp) Length = 294 | Back alignment and structure |
| >pdb|1EBE|A Chain A, Laue Diffraction Study On The Structure Of Cytochrome C Peroxidase Compound I Length = 294 | Back alignment and structure |
| >pdb|1S6V|A Chain A, Structure Of A Cytochrome C Peroxidase-Cytochrome C Site Specific Cross-Link Length = 294 | Back alignment and structure |
| >pdb|4A7M|A Chain A, Cytochrome C Peroxidase S81w Mutant Length = 296 | Back alignment and structure |
| >pdb|2XIL|A Chain A, The Structure Of Cytochrome C Peroxidase Compound I Length = 294 | Back alignment and structure |
| >pdb|2X07|A Chain A, Cytochrome C Peroxidase: Engineered Ascorbate Binding Site Length = 293 | Back alignment and structure |
| >pdb|1MK8|A Chain A, Crystal Structure Of A Mutant Cytochrome C Peroxidase Showing A Novel Trp-Tyr Covalent Cross-Link Length = 294 | Back alignment and structure |
| >pdb|1CCK|A Chain A, Altering Substrate Specificity Of Cytochrome C Peroxidase Towards A Small Molecular Substrate Peroxidase By Substituting Tyrosine For Phe 202 Length = 291 | Back alignment and structure |
| >pdb|1BEK|A Chain A, Effect Of Unnatural Heme Substitution On Kinetics Of Electron Transfer In Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|1A2F|A Chain A, Probing The Strength And Character Of An Asp-His-X Hydrogen Bond By Introducing Buried Charges Length = 291 | Back alignment and structure |
| >pdb|2CCP|A Chain A, X-Ray Structures Of Recombinant Yeast Cytochrome C Peroxidase And Three Heme-Cleft Mutants Prepared By Site-Directed Mutagenesis Length = 296 | Back alignment and structure |
| >pdb|1CCC|A Chain A, The Asp-His-Fe Triad Of Cytochrome C Peroxidase Controls The Reduction Potential, Electronic Structure, And Coupling Of The Tryptophan Free-Radical To The Heme Length = 297 | Back alignment and structure |
| >pdb|1CYF|A Chain A, Identifying The Physiological Electron Transfer Site Of Cytochrome C Peroxidase By Structure-Based Engineering Length = 296 | Back alignment and structure |
| >pdb|2PCB|A Chain A, Crystal Structure Of A Complex Between Electron Transfer Partners, Cytochrome C Peroxidase And Cytochrome C Length = 296 | Back alignment and structure |
| >pdb|2CEP|A Chain A, Role Of Met-230 In Intramolecular Electron Transfer Between The Oxyferryl Heme And Trp 191 In Cytochrome C Peroxidase Compound Ii Length = 296 | Back alignment and structure |
| >pdb|1CCB|A Chain A, The Asp-His-Fe Triad Of Cytochrome C Peroxidase Controls The Reduction Potential, Electronic Structure, And Coupling Of The Tryptophan Free-Radical To The Heme Length = 297 | Back alignment and structure |
| >pdb|1CCA|A Chain A, The Asp-His-Fe Triad Of Cytochrome C Peroxidase Controls The Reduction Potential, Electronic Structure, And Coupling Of The Tryptophan Free-Radical To The Heme Length = 297 | Back alignment and structure |
| >pdb|1A2G|A Chain A, Probing The Strength And Character Of An Asp-His-X Hydrogen Bond By Introducing Buried Charges Length = 291 | Back alignment and structure |
| >pdb|1BEP|A Chain A, Effect Of Unnatural Heme Substitution On Kinetics Of Electron Transfer In Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|2GB8|A Chain A, Solution Structure Of The Complex Between Yeast Iso-1- Cytochrome C And Yeast Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|6CCP|A Chain A, Effect Of Arginine-48 Replacement On The Reaction Between Cytochrome C Peroxidase And Hydrogen Peroxide Length = 296 | Back alignment and structure |
| >pdb|1CCL|A Chain A, Probing The Strength And Character Of An Asp-His-X Hydrogen Bond By Introducing Buried Charges Length = 291 | Back alignment and structure |
| >pdb|4CCX|A Chain A, Altering Substrate Specificity At The Heme Edge Of Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|3CCX|A Chain A, Altering Substrate Specificity At The Heme Edge Of Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|1CCI|A Chain A, How Flexible Are Proteins? Trapping Of A Flexible Loop Length = 294 | Back alignment and structure |
| >pdb|1DJ1|A Chain A, Crystal Structure Of R48a Mutant Of Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|7CCP|A Chain A, Effect Of Arginine-48 Replacement On The Reaction Between Cytochrome C Peroxidase And Hydrogen Peroxide Length = 296 | Back alignment and structure |
| >pdb|1BEQ|A Chain A, Interaction Between Proximal And Distals Regions Of Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|4CCP|A Chain A, X-Ray Structures Of Recombinant Yeast Cytochrome C Peroxidase And Three Heme-Cleft Mutants Prepared By Site-Directed Mutagenesis Length = 296 | Back alignment and structure |
| >pdb|1DCC|A Chain A, 2.2 Angstrom Structure Of Oxyperoxidase: A Model For The Enzyme:peroxide Complex Length = 296 | Back alignment and structure |
| >pdb|5CCP|A Chain A, Histidine 52 Is A Critical Residue For Rapid Formation Of Cytochrome C Peroxidase Compound I Length = 296 | Back alignment and structure |
| >pdb|1CCE|A Chain A, Construction Of A Bis-Aquo Heme Enzyme And Replacement With Exogenous Ligand Length = 291 | Back alignment and structure |
| >pdb|2IA8|A Chain A, Kinetic And Crystallographic Studies Of A Redesigned Manganese-Binding Site In Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|1DS4|A Chain A, Cytochrome C Peroxidase H175g Mutant, Imidazole Complex, Ph 6, 100k Length = 292 | Back alignment and structure |
| >pdb|1BVA|A Chain A, Manganese Binding Mutant In Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|1CPG|A Chain A, A Cation Binding Motif Stabilizes The Compound I Radical Of Cytochrome C Peroxidase Length = 296 | Back alignment and structure |
| >pdb|1BEM|A Chain A, Interaction Between Proximal And Distals Regions Of Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|1DSE|A Chain A, Cytochrome C Peroxidase H175g Mutant, Imidazole Complex, With Phosphate Bound, Ph 6, 100k Length = 292 | Back alignment and structure |
| >pdb|1CMU|A Chain A, The Role Of Aspartate-235 In The Binding Of Cations To An Artificial Cavity At The Radical Site Of Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|1CPD|A Chain A, A Cation Binding Motif Stabilizes The Compound I Radical Of Cytochrome C Peroxidase Length = 296 | Back alignment and structure |
| >pdb|2AQD|A Chain A, Cytochrome C Peroxidase (Ccp) In Complex With 2,5- Diaminopyridine Length = 294 | Back alignment and structure |
| >pdb|2RBU|X Chain X, Cytochrome C Peroxidase In Complex With Cyclopentane-Carboximidamide Length = 292 | Back alignment and structure |
| >pdb|2ANZ|A Chain A, Cytochrome C Peroxidase In Complex With 2,6-Diaminopyridine Length = 294 | Back alignment and structure |
| >pdb|1BEJ|A Chain A, Interaction Between Proximal And Distals Regions Of Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|3EXB|A Chain A, Crystal Structure Of Cytochrome C Peroxidase With A Proposed Electron Pathway Excised In A Complex With A Peptide Wire Length = 295 | Back alignment and structure |
| >pdb|1KXN|A Chain A, Crystal Structure Of Cytochrome C Peroxidase With A Proposed Electron Transfer Pathway Excised To Form A Ligand Binding Channel Length = 289 | Back alignment and structure |
| >pdb|1KXM|A Chain A, Crystal Structure Of Cytochrome C Peroxidase With A Proposed Electron Transfer Pathway Excised To Form A Ligand Binding Channel Length = 290 | Back alignment and structure |
| >pdb|1UB2|A Chain A, Crystal Structure Of Catalase-Peroxidase From Synechococcus Pcc 7942 Length = 720 | Back alignment and structure |
| >pdb|1MN1|A Chain A, Manganese Peroxidase Substrate Binding Site Mutant D179n Length = 357 | Back alignment and structure |
| >pdb|1MN2|A Chain A, Manganese Peroxidase Substrate Binding Site Mutant E35q, D179n Length = 357 | Back alignment and structure |
| >pdb|1YYD|A Chain A, High Resolution Crystal Structure Of Manganese Peroxidase Length = 357 | Back alignment and structure |
| >pdb|1ITK|A Chain A, Crystal Structure Of Catalase-peroxidase From Haloarcula Marismortui Length = 731 | Back alignment and structure |
| >pdb|3VLH|A Chain A, Crystal Structure Analysis Of The Arg409leu Variants Of Katg From Haloarcula Marismortui Length = 737 | Back alignment and structure |
| >pdb|3UW8|A Chain A, Crystal Structure Analysis Of The Ser305thr Variants Of Katg From Haloarcula Marismortui Length = 737 | Back alignment and structure |
| >pdb|3VLK|A Chain A, Crystal Structure Analysis Of The Ser305ala Variant Of Katg From Haloarcula Marismortui Length = 737 | Back alignment and structure |
| >pdb|2DV1|A Chain A, Crystal Structure Of D141e Mutant Of Bpkatg Length = 748 | Back alignment and structure |
| >pdb|1MWV|A Chain A, Crystal Structure Of Catalase-peroxidase Katg Of Burkholderia Pseudomallei Length = 714 | Back alignment and structure |
| >pdb|3N3S|A Chain A, Crystal Structure Of The E198a Variant Of Burkholderia Pseudomallei Catalase-Peroxidase Katg With Inh Length = 748 | Back alignment and structure |
| >pdb|1X7U|A Chain A, Crystal Structure Of The S324t Of Catalase-Peroxidase Katg Length = 748 | Back alignment and structure |
| >pdb|3N3Q|A Chain A, Crystal Structure Of The S324t Variant Of Burkholderia Pseudomallei Katg With Isonicotinic Acid Hydrazide Bound Length = 748 | Back alignment and structure |
| >pdb|2FXG|A Chain A, Crystal Structure Of Katg At Ph 4.5 Length = 748 | Back alignment and structure |
| >pdb|3VLM|A Chain A, Crystal Structure Analysis Of The Met244ala Variant Of Katg From Haloarcula Marismortui Length = 737 | Back alignment and structure |
| >pdb|2DV2|A Chain A, Crystal Structure Of D141e Mutant Of Bpkatg At Ph 8.0 Length = 748 | Back alignment and structure |
| >pdb|3RRW|A Chain A, Crystal Structure Of The Tl29 Protein From Arabidopsis Thaliana Length = 268 | Back alignment and structure |
| >pdb|3N3R|A Chain A, Crystal Structure Of The E198a Variant Of Catalase-Peroxidase Katg Of Burkholderia Pseudomallei Length = 748 | Back alignment and structure |
| >pdb|2FXJ|A Chain A, Crystal Structure Of Katg At Ph 8.5 Length = 748 | Back alignment and structure |
| >pdb|3FM6|A Chain A, Crystal Structure Analysis Of Fungal Versatile Peroxidase From Pleurotus Eryngii Length = 331 | Back alignment and structure |
| >pdb|4FEF|A Chain A, The Crystal Structures Of Several Mutants Of Pleurotus Eryngii Versatile Peroxidase Length = 315 | Back alignment and structure |
| >pdb|3Q3U|A Chain A, Trametes Cervina Lignin Peroxidase Length = 338 | Back alignment and structure |
| >pdb|4A5G|A Chain A, Raphanus Sativus Anionic Peroxidase. Length = 308 | Back alignment and structure |
| >pdb|2CCD|A Chain A, Crystal Structure Of The Catalase-Peroxidase (Katg) And S315t Mutant From Mycobacterium Tuberculosis Length = 740 | Back alignment and structure |
| >pdb|2CCA|A Chain A, Crystal Structure Of The Catalase-Peroxidase (Katg) And S315t Mutant From Mycobacterium Tuberculosis Length = 740 | Back alignment and structure |
| >pdb|1SJ2|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Catalase-Peroxidase Length = 743 | Back alignment and structure |
| >pdb|3UT2|A Chain A, Crystal Structure Of Fungal Magkatg2 Length = 764 | Back alignment and structure |
| >pdb|1B80|A Chain A, Rec. Lignin Peroxidase H8 Oxidatively Processed Length = 351 | Back alignment and structure |
| >pdb|1B85|A Chain A, Lignin Peroxidase Length = 351 | Back alignment and structure |
| >pdb|1B82|A Chain A, Pristine Recomb. Lignin Peroxidase H8 Length = 351 | Back alignment and structure |
| >pdb|1FHF|A Chain A, The Structure Of Soybean Peroxidase Length = 304 | Back alignment and structure |
| >pdb|1U2J|A Chain A, Crystal Structure Of The C-Terminal Domain From The Catalase-Peroxidase Katg Of Escherichia Coli (P21 21 21) Length = 326 | Back alignment and structure |
| >pdb|1U2K|A Chain A, Crystal Structure Of The C-Terminal Domain From The Catalase- Peroxidase Katg Of Escherichia Coli (I41) Length = 309 | Back alignment and structure |
| >pdb|1PA2|A Chain A, Arabidopsis Thaliana Peroxidase A2 Length = 306 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 201 | |||
| 3riv_A | 271 | Ascorbate peroxidase; alpha helical bundle, heme p | 1e-107 | |
| 2vcn_A | 261 | Ascorbate peroxidase; INH, APX, isoniazid, oxidore | 1e-99 | |
| 3e2o_A | 294 | CCP, cytochrome C peroxidase; cytochrome C peroxid | 2e-96 | |
| 1iyn_A | 295 | Chloroplastic ascorbate peroxidase; hydrogen perox | 1e-91 | |
| 3m5q_A | 357 | Manganese peroxidase 1; heme, Mn(II)-binding site, | 9e-73 | |
| 3fmu_A | 331 | VersatIle peroxidase VPL2; class II (fungal) perox | 8e-71 | |
| 1llp_A | 343 | LIP4.15, lignin peroxidase; heme protein, glyco pr | 7e-67 | |
| 3q3u_A | 338 | Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A | 1e-66 | |
| 3rrw_A | 268 | Thylakoid lumenal 29 kDa protein, chloroplastic; c | 1e-66 | |
| 2e39_A | 344 | Peroxidase; heme protein, coordination geometry of | 2e-65 | |
| 1itk_A | 731 | Catalase-peroxidase; heme protein, oxidoreductase; | 3e-29 | |
| 1itk_A | 731 | Catalase-peroxidase; heme protein, oxidoreductase; | 3e-10 | |
| 1ub2_A | 720 | Catalase-peroxidase; KATG, cyanobacteria, oxidored | 8e-29 | |
| 1ub2_A | 720 | Catalase-peroxidase; KATG, cyanobacteria, oxidored | 4e-12 | |
| 2cca_A | 740 | Peroxidase/catalase T; oxidoreductase, catalase-pe | 4e-28 | |
| 2cca_A | 740 | Peroxidase/catalase T; oxidoreductase, catalase-pe | 3e-10 | |
| 3n3r_A | 748 | Catalase-peroxidase; E198A variant, tuberclosis, i | 2e-27 | |
| 3n3r_A | 748 | Catalase-peroxidase; E198A variant, tuberclosis, i | 4e-08 | |
| 3ut2_A | 764 | Catalase-peroxidase 2; KATG, fungal, heme enzyme, | 1e-25 | |
| 3ut2_A | 764 | Catalase-peroxidase 2; KATG, fungal, heme enzyme, | 5e-11 | |
| 1qgj_A | 300 | Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A | 2e-10 | |
| 1sch_A | 294 | PNP, peanut peroxidase, major cationic isozyme; ca | 7e-10 | |
| 1fhf_A | 304 | SEED coat peroxidase; oxidoreductase; HET: HEM; 2. | 1e-09 | |
| 1bgp_A | 309 | Barley grain peroxidase; chromoprotein, oxidoreduc | 1e-09 | |
| 1u2k_A | 309 | Peroxidase/catalase HPI; KATG, catalase-peroxidase | 1e-09 | |
| 1pa2_A | 306 | Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45 | 3e-09 | |
| 3hdl_A | 304 | Royal PALM TREE peroxidase; glycosylated, oxidored | 3e-09 | |
| 1gwu_A | 309 | Peroxidase C1A; oxidoreductase, glycoprotein, heme | 5e-08 |
| >3riv_A Ascorbate peroxidase; alpha helical bundle, heme peroxidase, oxidoreductase; HET: HEM; 1.76A {Leishmania major} PDB: 3riw_A* Length = 271 | Back alignment and structure |
|---|
Score = 308 bits (790), Expect = e-107
Identities = 83/198 (41%), Positives = 114/198 (57%), Gaps = 8/198 (4%)
Query: 9 SEDYKKAVEKCKRKLRGFIAEK-NCAPLMLRIAWHSAGTYDVKTKTGGP-FGTMRLAAEQ 66
SE+ + + + I+EK P ++R+AWH A +YD K G P +MR E
Sbjct: 2 SEEPPFDIRALRADIEDMISEKLELGPSLIRLAWHEAASYDCFKKDGSPNSASMRFKPEC 61
Query: 67 AHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEP- 125
++ N GLDI + LE K+++P ISYADL+ LA V +E GGP IPF GR D +
Sbjct: 62 LYAGNKGLDIPRKALETLKKKYPQISYADLWVLAAYVAIEYMGGPTIPFCWGRVDAKDGS 121
Query: 126 --PQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNP 183
+GRLPD + H+R+VF ++G +D++ VAL G HT G CH E SG+ GPWT +
Sbjct: 122 VCGPDGRLPDGSKTQSHVREVFR-RLGFNDQETVALIGAHTCGECHIEFSGYHGPWTHDK 180
Query: 184 LIFDNSYFTYVSLGALDW 201
FDNS+FT L DW
Sbjct: 181 NGFDNSFFT--QLLDEDW 196
|
| >2vcn_A Ascorbate peroxidase; INH, APX, isoniazid, oxidoreductase; HET: HEM ISZ; 1.20A {Glycine max} PDB: 2ggn_X* 2ghd_X* 2ghe_X* 2ghc_X* 2vnx_X* 2vnz_X* 2vo2_X* 2wd4_A* 1oaf_A* 1oag_A* 1v0h_X* 2ghh_X* 2ghk_X* 2vcf_X* 2cl4_X* 2vcs_A* 2xi6_A* 2xif_A* 2xih_A* 2xj6_A* ... Length = 261 | Back alignment and structure |
|---|
| >3e2o_A CCP, cytochrome C peroxidase; cytochrome C peroxidase (CCP), heme, hydrogen peroxide, iron, metal-binding, mitochondrion; HET: HEM; 1.06A {Saccharomyces cerevisiae} PDB: 1z53_A* 1kok_A* 1sbm_A* 1sdq_A* 1s73_A* 1zby_A* 1zbz_A* 2b0z_A* 2b10_A* 2b11_A* 2b12_A* 2cyp_A* 2ycg_A* 2v23_A* 1ebe_A* 3r98_A* 3r99_A* 1mkr_A* 1mk8_A* 1mkq_A* ... Length = 294 | Back alignment and structure |
|---|
| >1iyn_A Chloroplastic ascorbate peroxidase; hydrogen peroxide, tobacco plant, stromal ascorbate peroxidase, oxidoreductase; HET: HEM; 1.60A {Nicotiana tabacum} SCOP: a.93.1.1 Length = 295 | Back alignment and structure |
|---|
| >3m5q_A Manganese peroxidase 1; heme, Mn(II)-binding site, Ca(II)-binding site, glycosylation, ultrahigh resolution, calcium; HET: NAG MAN HEM; 0.93A {Phanerochaete chrysosporium} PDB: 1mnp_A* 1yyg_A* 1yzp_A* 1yzr_A* 1yyd_A* 3m8m_A* 1mn1_A* 1mn2_A* Length = 357 | Back alignment and structure |
|---|
| >3fmu_A VersatIle peroxidase VPL2; class II (fungal) peroxidases, protoporphyrin IX, electron T lignin peroxidase, lignin degradation; HET: HEM; 1.04A {Pleurotus eryngii} PDB: 3fjw_A* 2boq_A* 3fm1_A* 3fm4_A* 3fm6_A* 3fkg_A* 2w23_A* 2vka_A* Length = 331 | Back alignment and structure |
|---|
| >1llp_A LIP4.15, lignin peroxidase; heme protein, glyco protein,, oxidoreductase; HET: NAG MAN A2G HEM; 1.70A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1lga_A* 1b80_A* 1b82_A* 1b85_A* 1qpa_A* Length = 343 | Back alignment and structure |
|---|
| >3q3u_A Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A {Trametes cervina} Length = 338 | Back alignment and structure |
|---|
| >3rrw_A Thylakoid lumenal 29 kDa protein, chloroplastic; chloroplast thylakoid lumen, plant protein; 2.50A {Arabidopsis thaliana} Length = 268 | Back alignment and structure |
|---|
| >2e39_A Peroxidase; heme protein, coordination geometry of heme iron, ARP, perox oxidoreductase; HET: NAG MAN HEM; 1.30A {'arthromyces ramosus'} SCOP: a.93.1.1 PDB: 1arp_A* 1arv_A* 1arw_A* 1arx_A* 1ary_A* 1c8i_A* 1ck6_A* 1gza_A* 1gzb_A* 1hsr_A* 1aru_A* 2e3a_A* 2e3b_A* 1lyk_A* 1lyc_A* 1ly9_A* 1h3j_A* 1ly8_A* Length = 344 | Back alignment and structure |
|---|
| >1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 Length = 731 | Back alignment and structure |
|---|
| >1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 Length = 731 | Back alignment and structure |
|---|
| >1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 Length = 720 | Back alignment and structure |
|---|
| >1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 Length = 720 | Back alignment and structure |
|---|
| >2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* Length = 740 | Back alignment and structure |
|---|
| >2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* Length = 740 | Back alignment and structure |
|---|
| >3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* Length = 748 | Back alignment and structure |
|---|
| >3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* Length = 748 | Back alignment and structure |
|---|
| >3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} Length = 764 | Back alignment and structure |
|---|
| >3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} Length = 764 | Back alignment and structure |
|---|
| >1qgj_A Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A {Arabidopsis thaliana} SCOP: a.93.1.1 Length = 300 | Back alignment and structure |
|---|
| >1sch_A PNP, peanut peroxidase, major cationic isozyme; calcium binding, glycosylation, oxidoreductase; HET: NAG HEM; 2.56A {Arachis hypogaea} SCOP: a.93.1.1 Length = 294 | Back alignment and structure |
|---|
| >1fhf_A SEED coat peroxidase; oxidoreductase; HET: HEM; 2.80A {Glycine max} SCOP: a.93.1.1 Length = 304 | Back alignment and structure |
|---|
| >1bgp_A Barley grain peroxidase; chromoprotein, oxidoreductase; HET: HEM; 1.90A {Hordeum vulgare} SCOP: a.93.1.1 Length = 309 | Back alignment and structure |
|---|
| >1u2k_A Peroxidase/catalase HPI; KATG, catalase-peroxidase, C-terminal domain, oxidoreductase; 2.00A {Escherichia coli} SCOP: a.93.1.3 PDB: 1u2l_A 1u2j_A Length = 309 | Back alignment and structure |
|---|
| >1pa2_A Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45A {Arabidopsis thaliana} SCOP: a.93.1.1 PDB: 1qo4_A* Length = 306 | Back alignment and structure |
|---|
| >3hdl_A Royal PALM TREE peroxidase; glycosylated, oxidoreductase; HET: HEM MES NAG FUC MAN; 1.85A {Roystonea regia} Length = 304 | Back alignment and structure |
|---|
| >1gwu_A Peroxidase C1A; oxidoreductase, glycoprotein, heme, multigene family, signal,; HET: HEM; 1.31A {Armoracia rusticana} SCOP: a.93.1.1 PDB: 1w4w_A* 1w4y_A* 1gwo_A* 2atj_A* 1gwt_A* 3atj_A* 1gx2_A* 7atj_A* 1h55_A* 1h58_A* 1h5a_A* 1h5c_A* 1h5d_A* 1h5e_A* 1h5f_A* 1h57_A* 1h5h_A* 1h5i_A* 1h5j_A* 1h5k_A* ... Length = 309 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 201 | |||
| 2vcn_A | 261 | Ascorbate peroxidase; INH, APX, isoniazid, oxidore | 100.0 | |
| 3hdl_A | 304 | Royal PALM TREE peroxidase; glycosylated, oxidored | 100.0 | |
| 1qgj_A | 300 | Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A | 100.0 | |
| 1sch_A | 294 | PNP, peanut peroxidase, major cationic isozyme; ca | 100.0 | |
| 1iyn_A | 295 | Chloroplastic ascorbate peroxidase; hydrogen perox | 100.0 | |
| 1pa2_A | 306 | Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45 | 100.0 | |
| 1fhf_A | 304 | SEED coat peroxidase; oxidoreductase; HET: HEM; 2. | 100.0 | |
| 1gwu_A | 309 | Peroxidase C1A; oxidoreductase, glycoprotein, heme | 100.0 | |
| 1bgp_A | 309 | Barley grain peroxidase; chromoprotein, oxidoreduc | 100.0 | |
| 3e2o_A | 294 | CCP, cytochrome C peroxidase; cytochrome C peroxid | 100.0 | |
| 3riv_A | 271 | Ascorbate peroxidase; alpha helical bundle, heme p | 100.0 | |
| 1u2k_A | 309 | Peroxidase/catalase HPI; KATG, catalase-peroxidase | 100.0 | |
| 3fmu_A | 331 | VersatIle peroxidase VPL2; class II (fungal) perox | 100.0 | |
| 3q3u_A | 338 | Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A | 100.0 | |
| 3m5q_A | 357 | Manganese peroxidase 1; heme, Mn(II)-binding site, | 100.0 | |
| 2cca_A | 740 | Peroxidase/catalase T; oxidoreductase, catalase-pe | 100.0 | |
| 2e39_A | 344 | Peroxidase; heme protein, coordination geometry of | 100.0 | |
| 1ub2_A | 720 | Catalase-peroxidase; KATG, cyanobacteria, oxidored | 100.0 | |
| 1itk_A | 731 | Catalase-peroxidase; heme protein, oxidoreductase; | 100.0 | |
| 1llp_A | 343 | LIP4.15, lignin peroxidase; heme protein, glyco pr | 100.0 | |
| 3vli_A | 737 | Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1 | 100.0 | |
| 3ut2_A | 764 | Catalase-peroxidase 2; KATG, fungal, heme enzyme, | 100.0 | |
| 3n3r_A | 748 | Catalase-peroxidase; E198A variant, tuberclosis, i | 100.0 | |
| 1itk_A | 731 | Catalase-peroxidase; heme protein, oxidoreductase; | 100.0 | |
| 2cca_A | 740 | Peroxidase/catalase T; oxidoreductase, catalase-pe | 100.0 | |
| 1ub2_A | 720 | Catalase-peroxidase; KATG, cyanobacteria, oxidored | 100.0 | |
| 3vli_A | 737 | Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1 | 100.0 | |
| 3rrw_A | 268 | Thylakoid lumenal 29 kDa protein, chloroplastic; c | 100.0 | |
| 3n3r_A | 748 | Catalase-peroxidase; E198A variant, tuberclosis, i | 100.0 | |
| 3ut2_A | 764 | Catalase-peroxidase 2; KATG, fungal, heme enzyme, | 100.0 |
| >2vcn_A Ascorbate peroxidase; INH, APX, isoniazid, oxidoreductase; HET: HEM ISZ; 1.20A {Glycine max} PDB: 2ggn_X* 2ghd_X* 2ghe_X* 2ghc_X* 2vnx_X* 2vnz_X* 2vo2_X* 2wd4_A* 1oaf_A* 1oag_A* 1v0h_X* 2ghh_X* 2ghk_X* 2vcf_X* 2cl4_X* 2vcs_A* 2xi6_A* 2xif_A* 2xih_A* 2xj6_A* ... | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-63 Score=427.57 Aligned_cols=196 Identities=77% Similarity=1.275 Sum_probs=190.0
Q ss_pred CCCCCChhHHHHHHHHHHHHHHhhHhhcCCchHHHHHHHhhhcCccccCCCCCCCCccccChHHhhccccCchHHHHHHH
Q 028971 2 TKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLL 81 (201)
Q Consensus 2 ~~~cp~~~~~v~~~v~~~~~~i~~~~~~~~~a~~~lRl~FHDc~~~d~~~~~gG~dgSi~~~~e~~~~~N~gl~~~~~~i 81 (201)
+++.|.+...|+++++++|++|++++++++++|++|||+||||++||++.+.+||||||++.+|+++++|.+|.+++++|
T Consensus 13 ~~~~~~~~~~y~~~~~~~r~~v~~~~~d~~~aa~llRL~FHDc~gcD~s~~~gg~~gsi~~~~E~~~~~N~~l~~g~~~i 92 (261)
T 2vcn_A 13 GKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAAHSAGTFDKGTKTGGPFGTIKHPAELAHSANNGLDIAVRLL 92 (261)
T ss_dssp CCCCCCCCHHHHHC-CHHHHHHHHHHHHHTCHHHHHHHHHHHHTTCBTTTTBCSSSSGGGSHHHHTSGGGTTHHHHHHHH
T ss_pred CCcCCCCcHHHHHHHHHHHHHHHHHHhCCCchHHHHHHHHccCCCCCcccCCCCCCccccchhhccCccccCHHHHHHHH
Confidence 57899999999999999999999999999999999999999999999999999999999999999999999998899999
Q ss_pred HHhHHhCCCCCHHHHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHhcCCCcccceeeec
Q 028971 82 EPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSG 161 (201)
Q Consensus 82 ~~iK~~~~~VS~ADiialaa~~av~~~GGP~~~v~~GR~D~~~s~~~~~lP~p~~~~~~l~~~F~~~~Gl~~~e~VaL~G 161 (201)
++||+++++|||||||+||||+||+.+|||.|+|++||+|+..+++.++||.|+.++++|++.|++++||+++|||||+|
T Consensus 93 ~~iK~~~~~VScADilalAardaV~~~GGP~~~v~~GRrD~~~s~~~~~lP~p~~~~~~l~~~F~~~~Gl~~~d~VaLsG 172 (261)
T 2vcn_A 93 EPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDKPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSG 172 (261)
T ss_dssp HHHHHTCTTSCHHHHHHHHHHHHHHHTTCCCCCCCCCCCCCSSCCCSCCSCCTTCCHHHHHHHHTTTTCCCHHHHHHHHG
T ss_pred HHHHHHhCCCCHHHHHHHHhhhheeeccCCcccCcCCCCCCCCCCcccccCCcccCHHHHHHHHHhhCCCChHHheeecc
Confidence 99999999999999999999999999999999999999999999988999999999999999997899999999999999
Q ss_pred ccccCcccCCCCCCCCCCCCCCCcccHHHHHHHhhC
Q 028971 162 GHTLGRCHKERSGFEGPWTRNPLIFDNSYFTYVSLG 197 (201)
Q Consensus 162 aHtiG~~~~~~~~~~g~~~~tp~~fDn~yy~~l~~~ 197 (201)
|||||.+||.|++|.|+|+.||.+|||+||++|+.+
T Consensus 173 aHTiG~ahc~r~~f~g~~~~tp~~FDN~Yy~~Ll~~ 208 (261)
T 2vcn_A 173 GHTIGAAHKERSGFEGPWTSNPLIFDNSYFTELLSG 208 (261)
T ss_dssp GGGSCEECTTTTSCCEESSSCTTSCSTHHHHHHHHC
T ss_pred CcccccccccCCCCCCCCCCcccccchHHHHHhhcc
Confidence 999999999999999999999999999999999988
|
| >3hdl_A Royal PALM TREE peroxidase; glycosylated, oxidoreductase; HET: HEM MES NAG FUC MAN; 1.85A {Roystonea regia} SCOP: a.93.1.0 | Back alignment and structure |
|---|
| >1qgj_A Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A {Arabidopsis thaliana} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >1sch_A PNP, peanut peroxidase, major cationic isozyme; calcium binding, glycosylation, oxidoreductase; HET: NAG HEM; 2.56A {Arachis hypogaea} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >1iyn_A Chloroplastic ascorbate peroxidase; hydrogen peroxide, tobacco plant, stromal ascorbate peroxidase, oxidoreductase; HET: HEM; 1.60A {Nicotiana tabacum} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >1pa2_A Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45A {Arabidopsis thaliana} SCOP: a.93.1.1 PDB: 1qo4_A* | Back alignment and structure |
|---|
| >1fhf_A SEED coat peroxidase; oxidoreductase; HET: HEM; 2.80A {Glycine max} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >1gwu_A Peroxidase C1A; oxidoreductase, glycoprotein, heme, multigene family, signal,; HET: HEM; 1.31A {Armoracia rusticana} SCOP: a.93.1.1 PDB: 1w4w_A* 1w4y_A* 1gwo_A* 2atj_A* 1gwt_A* 3atj_A* 1gx2_A* 7atj_A* 1h55_A* 1h58_A* 1h5a_A* 1h5c_A* 1h5d_A* 1h5e_A* 1h5f_A* 1h57_A* 1h5h_A* 1h5i_A* 1h5j_A* 1h5k_A* ... | Back alignment and structure |
|---|
| >1bgp_A Barley grain peroxidase; chromoprotein, oxidoreductase; HET: HEM; 1.90A {Hordeum vulgare} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >3e2o_A CCP, cytochrome C peroxidase; cytochrome C peroxidase (CCP), heme, hydrogen peroxide, iron, metal-binding, mitochondrion; HET: HEM; 1.06A {Saccharomyces cerevisiae} SCOP: a.93.1.1 PDB: 4a71_A* 1z53_A* 1kok_A* 1sbm_A* 1sdq_A* 1s73_A* 1zby_A* 1zbz_A* 2b0z_A* 2b10_A* 2b11_A* 2b12_A* 2cyp_A* 2ycg_A* 4a6z_A* 2v23_A* 1ebe_A* 3r98_A* 3r99_A* 1mkr_A* ... | Back alignment and structure |
|---|
| >3riv_A Ascorbate peroxidase; alpha helical bundle, heme peroxidase, oxidoreductase; HET: HEM; 1.76A {Leishmania major} PDB: 3riw_A* 4ged_A* | Back alignment and structure |
|---|
| >1u2k_A Peroxidase/catalase HPI; KATG, catalase-peroxidase, C-terminal domain, oxidoreductase; 2.00A {Escherichia coli} SCOP: a.93.1.3 PDB: 1u2l_A 1u2j_A | Back alignment and structure |
|---|
| >3fmu_A VersatIle peroxidase VPL2; class II (fungal) peroxidases, protoporphyrin IX, electron T lignin peroxidase, lignin degradation; HET: HEM; 1.04A {Pleurotus eryngii} PDB: 3fjw_A* 2boq_A* 3fm1_A* 3fm4_A* 3fm6_A* 3fkg_A* 2w23_A* 2vka_A* 4fcn_A* 4g05_A* 4fcs_A* 4fef_A* 4fdq_A* | Back alignment and structure |
|---|
| >3q3u_A Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A {Trametes cervina} SCOP: a.93.1.0 | Back alignment and structure |
|---|
| >3m5q_A Manganese peroxidase 1; heme, Mn(II)-binding site, Ca(II)-binding site, glycosylation, ultrahigh resolution, calcium; HET: NAG MAN HEM; 0.93A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1mnp_A* 1yyg_A* 1yzp_A* 1yzr_A* 1yyd_A* 3m8m_A* 1mn1_A* 1mn2_A* | Back alignment and structure |
|---|
| >2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* | Back alignment and structure |
|---|
| >2e39_A Peroxidase; heme protein, coordination geometry of heme iron, ARP, perox oxidoreductase; HET: NAG MAN HEM; 1.30A {'arthromyces ramosus'} SCOP: a.93.1.1 PDB: 1arp_A* 1arv_A* 1arw_A* 1arx_A* 1ary_A* 1c8i_A* 1ck6_A* 1gza_A* 1gzb_A* 1hsr_A* 1aru_A* 2e3a_A* 2e3b_A* 1lyk_A* 1lyc_A* 1ly9_A* 1h3j_A* 1ly8_A* | Back alignment and structure |
|---|
| >1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 | Back alignment and structure |
|---|
| >1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 | Back alignment and structure |
|---|
| >1llp_A LIP4.15, lignin peroxidase; heme protein, glyco protein,, oxidoreductase; HET: NAG MAN A2G HEM; 1.70A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1lga_A* 1b80_A* 1b82_A* 1b85_A* 1qpa_A* | Back alignment and structure |
|---|
| >3vli_A Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1.70A {Haloarcula marismortui} PDB: 3vlh_A* 3vlj_A* 3vlk_A* 3vll_A* 3uw8_A* 3vlm_A* 1itk_A* | Back alignment and structure |
|---|
| >3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} | Back alignment and structure |
|---|
| >3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* | Back alignment and structure |
|---|
| >1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 | Back alignment and structure |
|---|
| >2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* | Back alignment and structure |
|---|
| >1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 | Back alignment and structure |
|---|
| >3vli_A Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1.70A {Haloarcula marismortui} PDB: 3vlh_A* 3vlj_A* 3vlk_A* 3vll_A* 3uw8_A* 3vlm_A* 1itk_A* | Back alignment and structure |
|---|
| >3rrw_A Thylakoid lumenal 29 kDa protein, chloroplastic; chloroplast thylakoid lumen, plant protein; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* | Back alignment and structure |
|---|
| >3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 201 | ||||
| d1oafa_ | 250 | a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glyci | 2e-69 | |
| d2euta1 | 291 | a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {B | 3e-51 | |
| d1iyna_ | 275 | a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco | 4e-47 | |
| d1yyda1 | 357 | a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) { | 2e-42 | |
| d2e39a1 | 336 | a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) { | 2e-40 | |
| d1llpa_ | 343 | a.93.1.1 (A:) Fungal peroxidase (ligninase) {White | 1e-38 | |
| d1ub2a1 | 406 | a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Syne | 5e-36 | |
| d1mwva1 | 406 | a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burk | 4e-34 | |
| d2ccaa1 | 410 | a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Myco | 3e-32 | |
| d1itka1 | 406 | a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Arch | 5e-32 | |
| d1qgja_ | 300 | a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (A | 2e-31 | |
| d1gwua_ | 307 | a.93.1.1 (A:) Plant peroxidase {Horseradish (Armor | 4e-31 | |
| d1itka2 | 308 | a.93.1.3 (A:424-731) Catalase-peroxidase KatG {Arc | 5e-31 | |
| d1u2ka_ | 292 | a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholder | 5e-30 | |
| d1pa2a_ | 306 | a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (A | 2e-29 | |
| d1ub2a2 | 294 | a.93.1.3 (A:427-720) Catalase-peroxidase KatG {Syn | 1e-28 | |
| d2ccaa2 | 285 | a.93.1.3 (A:436-720) Catalase-peroxidase KatG {Myc | 2e-28 | |
| d1scha_ | 294 | a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hy | 4e-28 | |
| d1fhfa_ | 304 | a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine m | 5e-28 | |
| d1mwva2 | 308 | a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Bur | 6e-28 | |
| d1bgpa_ | 309 | a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vu | 8e-25 |
| >d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} Length = 250 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Heme-dependent peroxidases superfamily: Heme-dependent peroxidases family: CCP-like domain: Ascorbate peroxidase species: Soybean (Glycine max) [TaxId: 3847]
Score = 209 bits (534), Expect = 2e-69
Identities = 151/190 (79%), Positives = 168/190 (88%)
Query: 3 KNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRL 62
K+YPTVS DY+KAVEK K+KLRGFIAEK CAPLMLR+AWHSAGT+D TKTGGPFGT++
Sbjct: 3 KSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTIKH 62
Query: 63 AAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDK 122
AE AHSANNGLDIAVRLLEP K +FP +SYAD YQLAGVV VEVTGGP++PFHPGR+DK
Sbjct: 63 PAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDK 122
Query: 123 AEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRN 182
EPP EGRLPDA +G+DHLR VFG MGL+D+DIVALSGGHT+G HKERSGFEGPWT N
Sbjct: 123 PEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWTSN 182
Query: 183 PLIFDNSYFT 192
PLIFDNSYFT
Sbjct: 183 PLIFDNSYFT 192
|
| >d2euta1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 291 | Back information, alignment and structure |
|---|
| >d1iyna_ a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 275 | Back information, alignment and structure |
|---|
| >d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 357 | Back information, alignment and structure |
|---|
| >d2e39a1 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]} Length = 336 | Back information, alignment and structure |
|---|
| >d1llpa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {White rot basidiomycete (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 343 | Back information, alignment and structure |
|---|
| >d1ub2a1 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Length = 406 | Back information, alignment and structure |
|---|
| >d1mwva1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Length = 406 | Back information, alignment and structure |
|---|
| >d2ccaa1 a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Length = 410 | Back information, alignment and structure |
|---|
| >d1itka1 a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 406 | Back information, alignment and structure |
|---|
| >d1qgja_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase N [TaxId: 3702]} Length = 300 | Back information, alignment and structure |
|---|
| >d1gwua_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]} Length = 307 | Back information, alignment and structure |
|---|
| >d1itka2 a.93.1.3 (A:424-731) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 308 | Back information, alignment and structure |
|---|
| >d1u2ka_ a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Length = 292 | Back information, alignment and structure |
|---|
| >d1pa2a_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase A2 [TaxId: 3702]} Length = 306 | Back information, alignment and structure |
|---|
| >d1ub2a2 a.93.1.3 (A:427-720) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Length = 294 | Back information, alignment and structure |
|---|
| >d2ccaa2 a.93.1.3 (A:436-720) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Length = 285 | Back information, alignment and structure |
|---|
| >d1scha_ a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 294 | Back information, alignment and structure |
|---|
| >d1fhfa_ a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]} Length = 304 | Back information, alignment and structure |
|---|
| >d1mwva2 a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Length = 308 | Back information, alignment and structure |
|---|
| >d1bgpa_ a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vulgare), peroxidase 1 [TaxId: 4513]} Length = 309 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 201 | |||
| d1oafa_ | 250 | Ascorbate peroxidase {Soybean (Glycine max) [TaxId | 100.0 | |
| d1fhfa_ | 304 | Plant peroxidase {Soybean (Glycine max) [TaxId: 38 | 100.0 | |
| d1pa2a_ | 306 | Plant peroxidase {Mouse-ear cress (Arabidopsis tha | 100.0 | |
| d1qgja_ | 300 | Plant peroxidase {Mouse-ear cress (Arabidopsis tha | 100.0 | |
| d1iyna_ | 275 | Ascorbate peroxidase {Common tobacco (Nicotiana ta | 100.0 | |
| d1bgpa_ | 309 | Plant peroxidase {Barley (Hordeum vulgare), peroxi | 100.0 | |
| d1gwua_ | 307 | Plant peroxidase {Horseradish (Armoracia rusticana | 100.0 | |
| d2euta1 | 291 | Cytochrome c peroxidase, CCP {Baker's yeast (Sacch | 100.0 | |
| d1scha_ | 294 | Plant peroxidase {Peanut (Arachis hypogaea) [TaxId | 100.0 | |
| d2e39a1 | 336 | Fungal peroxidase (ligninase) {Arthromyces ramosus | 100.0 | |
| d1yyda1 | 357 | Fungal peroxidase (ligninase) {Basidomycetos fungu | 100.0 | |
| d1llpa_ | 343 | Fungal peroxidase (ligninase) {White rot basidiomy | 100.0 | |
| d1mwva2 | 308 | Catalase-peroxidase KatG {Burkholderia pseudomalle | 100.0 | |
| d1itka1 | 406 | Catalase-peroxidase KatG {Archaeon Haloarcula mari | 100.0 | |
| d1mwva1 | 406 | Catalase-peroxidase KatG {Burkholderia pseudomalle | 100.0 | |
| d1u2ka_ | 292 | Catalase-peroxidase KatG {Burkholderia pseudomalle | 100.0 | |
| d2ccaa1 | 410 | Catalase-peroxidase KatG {Mycobacterium tuberculos | 100.0 | |
| d2ccaa2 | 285 | Catalase-peroxidase KatG {Mycobacterium tuberculos | 100.0 | |
| d1ub2a2 | 294 | Catalase-peroxidase KatG {Synechococcus sp. pcc 79 | 100.0 | |
| d1ub2a1 | 406 | Catalase-peroxidase KatG {Synechococcus sp. pcc 79 | 100.0 | |
| d1itka2 | 308 | Catalase-peroxidase KatG {Archaeon Haloarcula mari | 100.0 |
| >d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Heme-dependent peroxidases superfamily: Heme-dependent peroxidases family: CCP-like domain: Ascorbate peroxidase species: Soybean (Glycine max) [TaxId: 3847]
Probab=100.00 E-value=3.4e-62 Score=414.71 Aligned_cols=196 Identities=77% Similarity=1.295 Sum_probs=190.2
Q ss_pred CCCCCChhHHHHHHHHHHHHHHhhHhhcCCchHHHHHHHhhhcCccccCCCCCCCCccccChHHhhccccCchHHHHHHH
Q 028971 2 TKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLL 81 (201)
Q Consensus 2 ~~~cp~~~~~v~~~v~~~~~~i~~~~~~~~~a~~~lRl~FHDc~~~d~~~~~gG~dgSi~~~~e~~~~~N~gl~~~~~~i 81 (201)
+++||.++.+|+++|++++++|++++.++.++|++|||+||||.+|+.+++.|||||||++.+|+++++|.||..+.+++
T Consensus 2 ~ks~p~~~~~~~~~~~~~~~~~~~~~~~~~~ap~llRl~FHDc~tf~~~~~~gg~~gs~~~~~E~~~~~N~Gl~~i~~~~ 81 (250)
T d1oafa_ 2 GKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTIKHPAELAHSANNGLDIAVRLL 81 (250)
T ss_dssp CCCCCCCCHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHTTCBTTTTBCSSSSGGGSHHHHTSGGGTTHHHHHHHH
T ss_pred CCCCCCchHHHHHHHHHHHHHHHHHHhccCcHHHHHHHHHcccccccCCCCCCCCCcccccccccccccccCHHHHHHHH
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999899999
Q ss_pred HHhHHhCCCCCHHHHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH-hcCCCcccceeee
Q 028971 82 EPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGA-QMGLSDKDIVALS 160 (201)
Q Consensus 82 ~~iK~~~~~VS~ADiialaa~~av~~~GGP~~~v~~GR~D~~~s~~~~~lP~p~~~~~~l~~~F~~-~~Gl~~~e~VaL~ 160 (201)
+++|++||.|||||||+|||++||+.+|||.|+|++||+|+..+.+.+.+|.|..+++++++.| . ++||+.+|||||+
T Consensus 82 ~~~~~~~p~VS~ADiialAa~~Av~~~GGp~~~~~~GR~D~~~~~~~g~~P~p~~~~~~l~~~F-~~~~Gl~~~e~VaL~ 160 (250)
T d1oafa_ 82 EPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDKPEPPPEGRLPDATKGSDHLRDVF-GKAMGLTDQDIVALS 160 (250)
T ss_dssp HHHHHTCTTSCHHHHHHHHHHHHHHHTTCCCCCCCCCCCCCSSCCCSCCSCCTTCCHHHHHHHH-TTTTCCCHHHHHHHH
T ss_pred HHHHhccCcccHHHHHHHHHHHHHHhcCCceeccCCCCccccCCCCcccCCChHHHHHHHHHHH-HHhcCCCHHHHHHHh
Confidence 9999999999999999999999999999999999999999999999999999999999999999 7 5799999999999
Q ss_pred cccccCcccCCCCCCCCCCCCCCCcccHHHHHHHhhCC
Q 028971 161 GGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTYVSLGA 198 (201)
Q Consensus 161 GaHtiG~~~~~~~~~~g~~~~tp~~fDn~yy~~l~~~~ 198 (201)
||||||.+||..+++.|+|+.||.+|||+||++|++++
T Consensus 161 GaHTiG~~h~~~s~~~~~~~~tP~~fDN~Yf~~ll~~~ 198 (250)
T d1oafa_ 161 GGHTIGAAHKERSGFEGPWTSNPLIFDNSYFTELLSGE 198 (250)
T ss_dssp GGGGSCEECTTTTSCCEESSSCTTCCSTHHHHHHHHCC
T ss_pred hhhhhhhhcccccccccccccccchhhhHHHHHHHhcc
Confidence 99999999999999999999999999999999999875
|
| >d1fhfa_ a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1pa2a_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase A2 [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1qgja_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase N [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1iyna_ a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1bgpa_ a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vulgare), peroxidase 1 [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1gwua_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]} | Back information, alignment and structure |
|---|
| >d2euta1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1scha_ a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hypogaea) [TaxId: 3818]} | Back information, alignment and structure |
|---|
| >d2e39a1 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]} | Back information, alignment and structure |
|---|
| >d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d1llpa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {White rot basidiomycete (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d1mwva2 a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1itka1 a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1mwva1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1u2ka_ a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d2ccaa1 a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ccaa2 a.93.1.3 (A:436-720) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ub2a2 a.93.1.3 (A:427-720) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1ub2a1 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1itka2 a.93.1.3 (A:424-731) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|