Citrus Sinensis ID: 028986

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MGCSGSVPARSSGQSGGLNNLENAGSSDAKNLRVKLVLLGDSGVGKSCIVLRFVRGQFDPTSKVTVGASFLSQTIALQDSTTVKFEIWDTAGQERYAALAPLYYRGAAVAVVVYDITSPDSFNKAQYWVKELQKHGSPDIVMALVGNKADLHEKREVPAQDGIEYAEKNGMFFIETSAKTADNINQLFEVLITCTSSYCS
ccccccccccccccccccccccccccccccEEEEEEEEEccccccHHHHHHHHHcccccccccccccEEEEEcEEEEccccEEEEEEEEcccccccccccHHHHHcccEEEEEEEcccHHHHHHHHHHHHHHHHccccccEEEEEEEcccccccccccHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHHHcccc
*******************************LRVKLVLLGDSGVGKSCIVLRFVRGQFDPTSKVTVGASFLSQTIALQDSTTVKFEIWDTAGQERYAALAPLYYRGAAVAVVVYDITSPDSFNKAQYWVKELQKHGSPDIVMALVGNKADLHEKREVPAQDGIEYAEKNGMFFIETSAKTADNINQLFEVLITCTSSY**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGCSGSVPARSSGQSGGLNNLENAGSSDAKNLRVKLVLLGDSGVGKSCIVLRFVRGQFDPTSKVTVGASFLSQTIALQDSTTVKFEIWDTAGQERYAALAPLYYRGAAVAVVVYDITSPDSFNKAQYWVKELQKHGSPDIVMALVGNKADLHEKREVPAQDGIEYAEKNGMFFIETSAKTADNINQLFEVLITCTSSYCS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related protein RABF1 Endosomal protein probably involved in endocytosis. Probably not involved in vacuolar trafficking.confidentQ9CB01
Ras-related protein Rab-5A Required for the fusion of plasma membranes and early endosomes.probableQ86JP3
GTP-binding protein ypt5 Protein transport. Probably involved in vesicular traffic.probableP36586

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OIL, chain A
Confidence level:very confident
Coverage over the Query: 28-198
View the alignment between query and template
View the model in PyMOL