Citrus Sinensis ID: 028989

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200

MESNLWSNRLSTASSRRYHHQSRSDLFIGGGYDETDGDDDLNAMFLCPFCAEDFDIVGLCCHIDEDHPIEAKNGVCPVCAKRVGTDIVSHITMQHGNFFKIQRKRRLRRGGPNSTFSLLRKELRDGNLQSLLGGSSCFVSSSNTEADPLLSSFIFNTPKVDEPLSVQPLSITEPTLVKESSNENLHERYVNRHFYLFYCF

cccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccHHHHHHHHHcccHHHHcccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccEEEEEEc

*****W*******************LFIGGGYDETDGDDDLNAMFLCPFCAEDFDIVGLCCHIDEDHPIEAKNGVCPVCAKRVGTDIVSHITMQHGNFFKIQRKR*************************LLGG**************LLSSFIFNT*******************************YVNRHFYLFYCF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein DEHYDRATION-INDUCED 19 homolog 2		probable	Q5W794
Protein DEHYDRATION-INDUCED 19 homolog 4		probable	Q8VXU6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RPC, chain A
Confidence level:probable
Coverage over the Query: 40-96
View the alignment between query and template
View the model in PyMOL