Citrus Sinensis ID: 028989

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MESNLWSNRLSTASSRRYHHQSRSDLFIGGGYDETDGDDDLNAMFLCPFCAEDFDIVGLCCHIDEDHPIEAKNGVCPVCAKRVGTDIVSHITMQHGNFFKIQRKRRLRRGGPNSTFSLLRKELRDGNLQSLLGGSSCFVSSSNTEADPLLSSFIFNTPKVDEPLSVQPLSITEPTLVKESSNENLHERYVNRHFYLFYCF
cccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccHHHHHHHHHcccHHHHcccccccccccccccccccHHHccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccHHHHcccccEEEEEEc
cccHHHHHHHHHcHHHHHHHHHcccHHcccccHHccccHHHHHHcccccccccccEHHHHHccHcccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHcHHHHHccHHHHccccccccccccccccccccHHEcccccccccccccccccccccccccccccccHHcccccEEEEEEEc
mesnlwsnrlstassrryhhqsrsdlfigggydetdgdddlnamflcpfcaedfdivglcchidedhpieakngvcpvcakrvgtDIVSHITMQHGNFFKIQRKrrlrrggpnstFSLLRKELRDgnlqsllggsscfvsssnteadpllssfifntpkvdeplsvqplsiteptlvkessnenlheryvnrhfYLFYCF
MESNLWSNRLSTassrryhhqsrsdlFIGGGYDETDGDDDLNAMFLCPFCAEDFDIVGLCCHIDEDHPIEAKNGVCPVCAKRVGTDIVSHitmqhgnffkiqrkrrlrrggpnsTFSLLRKELRDGNLQSLLGGSSCFVSSSNTEADPLLSSFIFNTPKVDEPLsvqplsiteptlvkessnenlheryvnrHFYLFYCF
MESNLWSNRLSTASSRRYHHQSRSDLFIgggydetdgdddLNAMFLCPFCAEDFDIVGLCCHIDEDHPIEAKNGVCPVCAKRVGTDIVSHITMQHGNFFKIQRKRRLRRGGPNSTFSLLRKELRDGNLQSLLGGSSCFVSSSNTEADPLLSSFIFNTPKVDEPLSVQPLSITEPTLVKESSNENLHERYVNRHFYLFYCF
*************************LFIGGGYDETDGDDDLNAMFLCPFCAEDFDIVGLCCHIDEDHPIEAKNGVCPVCAKRVGTDIVSHITMQHGNFFKIQRKR*************************LLGGSSCFV*********LLSSFIFNT***************************LHERYVNRHFYLFYC*
***NLW**************************DETDGDDDLNAMFLCPFCAEDFDIVGLCCHIDEDHPIEAKNGVCPVCAKRVGTDIVSHITMQHG*****************************************************LSSFI**************************************HFYLFYCF
*********************SRSDLFIGGGYDETDGDDDLNAMFLCPFCAEDFDIVGLCCHIDEDHPIEAKNGVCPVCAKRVGTDIVSHITMQHGNFFKIQRKRRLRRGGPNSTFSLLRKELRDGNLQSLLGGSSCFVSSSNTEADPLLSSFIFNTPKVDEPLSVQPLSITEPTLVKESSNENLHERYVNRHFYLFYCF
*****W******ASSRRYHHQSRSDLFIGGGYDETDGDDDLNAMFLCPFCAEDFDIVGLCCHIDEDHPIEAKNGVCPVCAKRVGTDIVSHITMQHGNFFKIQRKRR******NSTFSLLRKELRDGNLQSLLGG*********TEADPLLSSFIFNTPK*****************************YVNRHFYLFYCF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESNLWSNRLSTASSRRYHHQSRSDLFIGGGYDETDGDDDLNAMFLCPFCAEDFDIVGLCCHIDEDHPIEAKNGVCPVCAKRVGTDIVSHITMQHGNFFKIQRKRRLRRGGPNSTFSLLRKELRDGNLQSLLGGSSCFVSSSNTEADPLLSSFIFNTPKVDEPLSVQPLSITEPTLVKESSNENLHERYVNRHFYLFYCF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query200 2.2.26 [Sep-21-2011]
Q8VXU6224 Protein DEHYDRATION-INDUC yes no 0.815 0.727 0.630 4e-50
Q9FJ17211 Protein DEHYDRATION-INDUC no no 0.945 0.895 0.524 6e-50
Q84J70223 Protein DEHYDRATION-INDUC no no 0.935 0.838 0.522 5e-48
Q6NM26222 Protein DEHYDRATION-INDUC no no 0.94 0.846 0.482 2e-45
Q39083206 Protein DEHYDRATION-INDUC no no 0.905 0.878 0.491 3e-44
Q5W794233 Protein DEHYDRATION-INDUC yes no 0.7 0.600 0.513 3e-34
Q688X9226 Protein DEHYDRATION-INDUC no no 0.85 0.752 0.398 2e-29
Q5QMP3246 Protein DEHYDRATION-INDUC no no 0.725 0.589 0.386 4e-24
O04259214 Protein DEHYDRATION-INDUC no no 0.76 0.710 0.380 3e-22
Q6H6E6245 Protein DEHYDRATION-INDUC no no 0.675 0.551 0.363 7e-18
>sp|Q8VXU6|DI194_ARATH Protein DEHYDRATION-INDUCED 19 homolog 4 OS=Arabidopsis thaliana GN=DI19-4 PE=1 SV=1 Back     alignment and function desciption
 Score =  197 bits (501), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 134/168 (79%), Gaps = 5/168 (2%)

Query: 25  DLFIGGGYDETDGDDDLNAMFLCPFCAEDFDIVGLCCHIDEDHPIEAKNGVCPVCAKRVG 84
           DL++GGGY++ +G+DDL A F+CPFCAEDFDIVGLCCHIDE+HP+EAKNGVCPVC KRVG
Sbjct: 27  DLYLGGGYEDLEGEDDLKAEFICPFCAEDFDIVGLCCHIDEEHPVEAKNGVCPVCTKRVG 86

Query: 85  TDIVSHITMQHGNFFKIQRKRRLRRGGPNSTFSLLRKELRDGNLQSLLGGSSCFVSSSNT 144
            DIV HIT QH NFFK+QR+RRLRRGG +ST+  L+KELR+ NLQSLLGGSS F SS+N 
Sbjct: 87  LDIVGHITTQHANFFKVQRRRRLRRGGYSSTYLALKKELREANLQSLLGGSSSFTSSTNI 146

Query: 145 EADPLLSSFIFNTPKVDEPL--SVQPLSITEPTL---VKESSNENLHE 187
           ++DPLLSSF+FN+P V++    S  P+++        +KES   ++ E
Sbjct: 147 DSDPLLSSFMFNSPSVNQSANKSATPVTVGNAATKVSIKESLKRDIQE 194

Arabidopsis thaliana (taxid: 3702)
>sp|Q9FJ17|DI197_ARATH Protein DEHYDRATION-INDUCED 19 homolog 7 OS=Arabidopsis thaliana GN=DI19-7 PE=1 SV=2 Back     alignment and function description
>sp|Q84J70|DI193_ARATH Protein DEHYDRATION-INDUCED 19 homolog 3 OS=Arabidopsis thaliana GN=DI19-3 PE=1 SV=1 Back     alignment and function description
>sp|Q6NM26|DI196_ARATH Protein DEHYDRATION-INDUCED 19 homolog 6 OS=Arabidopsis thaliana GN=DI19-6 PE=1 SV=1 Back     alignment and function description
>sp|Q39083|DI191_ARATH Protein DEHYDRATION-INDUCED 19 OS=Arabidopsis thaliana GN=DI19-1 PE=1 SV=2 Back     alignment and function description
>sp|Q5W794|DI192_ORYSJ Protein DEHYDRATION-INDUCED 19 homolog 2 OS=Oryza sativa subsp. japonica GN=DI19-2 PE=2 SV=2 Back     alignment and function description
>sp|Q688X9|DI191_ORYSJ Protein DEHYDRATION-INDUCED 19 OS=Oryza sativa subsp. japonica GN=DI19-1 PE=2 SV=1 Back     alignment and function description
>sp|Q5QMP3|DI193_ORYSJ Protein DEHYDRATION-INDUCED 19 homolog 3 OS=Oryza sativa subsp. japonica GN=DI19-3 PE=2 SV=1 Back     alignment and function description
>sp|O04259|DI195_ARATH Protein DEHYDRATION-INDUCED 19 homolog 5 OS=Arabidopsis thaliana GN=DI19-5 PE=1 SV=2 Back     alignment and function description
>sp|Q6H6E6|DI194_ORYSJ Protein DEHYDRATION-INDUCED 19 homolog 4 OS=Oryza sativa subsp. japonica GN=DI19-4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query200
224110250215 predicted protein [Populus trichocarpa] 0.92 0.855 0.692 3e-69
224130330213 predicted protein [Populus trichocarpa] 0.93 0.873 0.670 2e-67
224122996220 predicted protein [Populus trichocarpa] 0.915 0.831 0.636 1e-62
255542834220 conserved hypothetical protein [Ricinus 0.93 0.845 0.611 7e-60
356576825219 PREDICTED: protein DEHYDRATION-INDUCED 1 0.89 0.812 0.652 3e-59
356535030219 PREDICTED: protein DEHYDRATION-INDUCED 1 0.89 0.812 0.652 1e-58
310833352219 dehydration-induced 19-like protein [Gos 0.925 0.844 0.606 2e-57
356576827223 PREDICTED: protein DEHYDRATION-INDUCED 1 0.89 0.798 0.638 2e-57
388517547221 unknown [Lotus japonicus] 0.9 0.814 0.657 1e-56
449435611220 PREDICTED: protein DEHYDRATION-INDUCED 1 0.925 0.840 0.578 5e-56
>gi|224110250|ref|XP_002315460.1| predicted protein [Populus trichocarpa] gi|222864500|gb|EEF01631.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 154/192 (80%), Gaps = 8/192 (4%)

Query: 1   MESNLWSNRLSTASSRRYHHQSRSDLFIGGGYDETDGDDDLNAMFLCPFCAEDFDIVGLC 60
           M S+ W +R ST SSRRY  Q+RSDL     ++ET+ ++DL A +LCPFCAEDFD+VGL 
Sbjct: 1   MASDSWVSRFST-SSRRY--QTRSDL-----HEETEAEEDLKAEYLCPFCAEDFDVVGLF 52

Query: 61  CHIDEDHPIEAKNGVCPVCAKRVGTDIVSHITMQHGNFFKIQRKRRLRRGGPNSTFSLLR 120
           CHIDEDHP+EAKNGVCPVCAKRVG DIVSHIT QHGNFFK+QRKRRLR+GG NS FS+LR
Sbjct: 53  CHIDEDHPVEAKNGVCPVCAKRVGMDIVSHITGQHGNFFKVQRKRRLRKGGANSAFSILR 112

Query: 121 KELRDGNLQSLLGGSSCFVSSSNTEADPLLSSFIFNTPKVDEPLSVQPLSITEPTLVKES 180
           KELR+G+LQSLLGGSSCFVSSSNTE DPLLS FIFN P  DE L+ +PLS  E + VK S
Sbjct: 113 KELREGSLQSLLGGSSCFVSSSNTEPDPLLSPFIFNPPGFDEALNAKPLSSVEASSVKGS 172

Query: 181 SNENLHERYVNR 192
           + E   ER V +
Sbjct: 173 TTEEFLERKVQQ 184

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224130330|ref|XP_002328582.1| predicted protein [Populus trichocarpa] gi|222838564|gb|EEE76929.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224122996|ref|XP_002318968.1| predicted protein [Populus trichocarpa] gi|222857344|gb|EEE94891.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255542834|ref|XP_002512480.1| conserved hypothetical protein [Ricinus communis] gi|223548441|gb|EEF49932.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356576825|ref|XP_003556530.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 3-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356535030|ref|XP_003536052.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 3-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|310833352|gb|ADP30960.1| dehydration-induced 19-like protein [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|356576827|ref|XP_003556531.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 3-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|388517547|gb|AFK46835.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449435611|ref|XP_004135588.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 3-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query200
TAIR|locus:2155934211 HRB1 "HYPERSENSITIVE TO RED AN 0.885 0.838 0.553 6.7e-49
TAIR|locus:2078062223 AT3G05700 [Arabidopsis thalian 0.915 0.820 0.533 1.3e-45
TAIR|locus:2148528222 AT5G26990 [Arabidopsis thalian 0.935 0.842 0.474 3.2e-42
TAIR|locus:2083363234 AT3G06760 [Arabidopsis thalian 0.93 0.794 0.458 1.9e-35
TAIR|locus:2196125221 AT1G02750 [Arabidopsis thalian 0.87 0.787 0.329 4.1e-17
TAIR|locus:2137819228 AT4G02200 [Arabidopsis thalian 0.62 0.543 0.378 6.7e-17
TAIR|locus:2155934 HRB1 "HYPERSENSITIVE TO RED AND BLUE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 510 (184.6 bits), Expect = 6.7e-49, P = 6.7e-49
 Identities = 108/195 (55%), Positives = 134/195 (68%)

Query:     1 MESNLWSNR----LSTASSRRYHHQSRSDLFIXXXXXXXXXXXXLNAMFLCPFCAEDFDI 56
             M+SN W N      S+ SSRRY  QSRSDL++            L A F+CPFCA++FDI
Sbjct:     1 MDSNSWINCPPVFSSSPSSRRY--QSRSDLYLGDVEGEDD----LKAEFMCPFCADEFDI 54

Query:    57 VGLCCHIDEDHPIEAKNGVCPVCAKRVGTDIVSHITMQHGNFFKIQRKRRLRRGGPNSTF 116
             VGLCCHID +HP+EAKNGVCPVC K+VG DIV HIT QHGN FK+QR+RRLR+GG +ST+
Sbjct:    55 VGLCCHIDVNHPVEAKNGVCPVCTKKVGLDIVGHITTQHGNVFKVQRRRRLRKGGYSSTY 114

Query:   117 SLLRKELRDGNLQSLLGGSSCFVSSSNTEADPLLSSFIFNTPKV------DEPLSVQPLS 170
               L+KELR+ NLQSL GGSS F+ SSN ++DPLLSSF+F  P        D    V P  
Sbjct:   115 LTLKKELREANLQSL-GGSSTFIPSSNIDSDPLLSSFMFKPPSAIPITEGDSVAQVSPKD 173

Query:   171 ITEPTLVKES-SNEN 184
              ++  + +ES SNE+
Sbjct:   174 TSKSKIQQESFSNED 188
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0009414 "response to water deprivation" evidence=ISS
GO:0009785 "blue light signaling pathway" evidence=IMP
GO:0010161 "red light signaling pathway" evidence=IMP
TAIR|locus:2078062 AT3G05700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148528 AT5G26990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083363 AT3G06760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196125 AT1G02750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137819 AT4G02200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5W794DI192_ORYSJNo assigned EC number0.51310.70.6008yesno
Q8VXU6DI194_ARATHNo assigned EC number0.63090.8150.7276yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
pfam05605209 pfam05605, Di19, Drought induced 19 protein (Di19) 5e-77
>gnl|CDD|218654 pfam05605, Di19, Drought induced 19 protein (Di19) Back     alignment and domain information 
 Score =  229 bits (585), Expect = 5e-77
 Identities = 103/183 (56%), Positives = 132/183 (72%), Gaps = 7/183 (3%)

Query: 9   RLSTASSRRYHHQSRSDLFIGGGYDETDGDDDLNAMFLCPFCAEDFDIVGLCCHIDEDHP 68
             S ++S +    SRSDL+    +++ +G+D++   F CPFC EDFDIV LCCHIDE+HP
Sbjct: 1   HASASASYQRALPSRSDLY---LFEDIEGEDEVREEFPCPFCYEDFDIVSLCCHIDEEHP 57

Query: 69  IEAKNGVCPVCAKRVGTDIVSHITMQHGNFFKIQRKRRLRRGGPNSTFSLLRKELRDGNL 128
            EAKNGVCPVCA RVG D+V+HIT+QHG+ FK+QR+RRLRRGG +S  SLL++ELRDGNL
Sbjct: 58  FEAKNGVCPVCADRVGKDMVAHITVQHGHLFKMQRRRRLRRGGSSSALSLLKRELRDGNL 117

Query: 129 QSLLGGSSCFVSSSNTE---ADPLLSSFIFNTPKVDEPLSVQPLSITEPTLVKESSNENL 185
           QSLL GSSC  SSSN      DPLLSSFI ++P  D   + +  S TE +   +SS++ L
Sbjct: 118 QSLL-GSSCMSSSSNASDSAPDPLLSSFICSSPSADTSSTSKSDSSTEGSASAKSSDQKL 176

Query: 186 HER 188
            ER
Sbjct: 177 SER 179

This family consists of several drought induced 19 (Di19) like proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought. The precise function of Di19 is unknown. Length = 209

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 200
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 99.8
PF14571105 Di19_C: Stress-induced protein Di19, C-terminal 99.79
KOG1280 381 consensus Uncharacterized conserved protein contai 99.02
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 94.77
COG5236493 Uncharacterized conserved protein, contains RING Z 94.57
KOG292367 consensus Uncharacterized conserved protein [Funct 94.08
COG521667 Uncharacterized conserved protein [Function unknow 93.96
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 93.05
PHA0073279 hypothetical protein 92.74
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 92.3
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 92.02
PLN03086567 PRLI-interacting factor K; Provisional 91.63
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 91.46
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 90.87
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 90.2
smart00531147 TFIIE Transcription initiation factor IIE. 89.92
PHA00733128 hypothetical protein 87.5
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 87.25
PHA0276855 hypothetical protein; Provisional 86.94
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 86.68
KOG1842 505 consensus FYVE finger-containing protein [General 84.81
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 84.8
PLN03086567 PRLI-interacting factor K; Provisional 84.59
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 84.56
smart0050463 Ubox Modified RING finger domain. Modified RING fi 83.41
PRK0971064 lar restriction alleviation and modification prote 83.4
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 83.03
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 81.2
PF0217660 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 81.19
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 80.34
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information 
Probab=99.80  E-value=2.9e-20  Score=127.49  Aligned_cols=54  Identities=37%  Similarity=0.865  Sum_probs=52.2

Q ss_pred             ceecCCCCcccccHHHHHhhhhhcCCCCCCcccccccccccchhhhhhhhhhcc
Q 028989           43 AMFLCPFCAEDFDIVGLCCHIDEDHPIEAKNGVCPVCAKRVGTDIVSHITMQHG   96 (200)
Q Consensus        43 ~~F~CPfC~e~fD~~~Lc~H~~~eH~~e~k~vVCPICa~~v~~d~v~Hlt~qH~   96 (200)
                      ++|+||||+++||+.+|+.|+.++|+.+.+++|||||+.+++.||++||+.+||
T Consensus         1 ~~f~CP~C~~~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~~~l~~Hl~~~H~   54 (54)
T PF05605_consen    1 DSFTCPYCGKGFSESSLVEHCEDEHRSESKNVVCPICSSRVTDNLIRHLNSQHR   54 (54)
T ss_pred             CCcCCCCCCCccCHHHHHHHHHhHCcCCCCCccCCCchhhhhhHHHHHHHHhcC
Confidence            379999999999999999999999999999999999999999999999999996

Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
>PF14571 Di19_C: Stress-induced protein Di19, C-terminal Back     alignment and domain information
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2923 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5216 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>KOG1842 consensus FYVE finger-containing protein [General function prediction only] Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PRK09710 lar restriction alleviation and modification protein; Reviewed Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query200
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 97.76
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 97.75
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 97.31
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 97.21
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 97.16
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 97.12
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 97.01
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 97.01
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 96.84
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 96.74
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 96.73
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 96.72
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 96.7
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 96.69
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 96.68
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 96.63
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 96.62
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 96.59
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 96.53
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 96.52
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 96.51
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 96.5
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 96.49
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 96.44
2lv2_A85 Insulinoma-associated protein 1; structural genomi 96.43
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 96.42
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 96.41
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 96.4
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 96.39
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 96.31
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 96.23
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 96.16
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 95.78
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 95.75
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 95.67
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 95.61
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 95.5
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 95.45
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 95.41
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 95.38
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 95.32
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 95.26
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 95.24
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 95.23
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 95.23
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 95.2
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 95.14
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 95.1
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 95.02
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 94.99
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 94.94
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.91
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.86
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 94.83
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 94.82
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.78
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.76
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 94.73
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.69
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.67
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 94.65
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 94.64
1tf6_A190 Protein (transcription factor IIIA); complex (tran 94.61
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 94.61
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.61
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.57
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.56
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.56
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 94.55
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 94.53
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 94.51
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.51
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.48
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 94.46
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 94.46
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.43
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 94.41
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 94.41
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.41
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.37
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.32
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.3
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.26
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.26
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.25
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 94.2
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.17
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 94.16
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.16
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.12
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 94.1
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 94.1
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 94.06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 94.03
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.03
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 94.02
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 93.93
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 93.87
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 93.79
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 93.78
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 93.78
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 93.77
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 93.74
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 93.73
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 93.7
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 93.69
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 93.55
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 93.53
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 93.5
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 93.46
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 93.36
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 93.16
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 92.89
2epa_A72 Krueppel-like factor 10; transforming growth facto 92.85
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 92.63
1tf6_A190 Protein (transcription factor IIIA); complex (tran 92.14
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 91.26
2ysl_A73 Tripartite motif-containing protein 31; ring-type 90.49
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 90.33
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.03
1vd4_A62 Transcription initiation factor IIE, alpha subunit 89.48
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.0
2lv2_A85 Insulinoma-associated protein 1; structural genomi 88.93
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.84
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.83
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.83
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 88.7
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.68
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 88.68
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 88.67
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.6
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 88.41
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.38
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.36
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 88.27
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.27
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.22
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 88.02
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.95
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 87.95
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 87.58
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 87.47
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 87.37
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.3
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 87.01
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 87.01
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 86.73
1paa_A30 Yeast transcription factor ADR1; transcription reg 86.7
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 86.63
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 86.59
1wge_A83 Hypothetical protein 2610018L09RIK; diphthamide,CS 86.52
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 86.15
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 85.63
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 85.33
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 85.28
2jr7_A89 DPH3 homolog; DESR1, CSL zinc finger, metal bindin 85.06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 85.05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 85.02
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 84.75
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 84.75
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 84.69
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 84.33
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 84.18
1wir_A121 Protein arginine N-methyltransferase 3; C2H2 zinc 84.12
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 84.08
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 83.94
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 83.76
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 83.1
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 82.98
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 82.82
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 82.43
1yop_A83 KTI11P; zinc finger, metal binding protein; NMR {S 82.41
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 82.23
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 82.18
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 82.09
2ysj_A63 Tripartite motif-containing protein 31; ring-type 82.01
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 81.96
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 81.95
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 81.55
1ard_A29 Yeast transcription factor ADR1; transcription reg 81.46
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 81.02
2ecw_A85 Tripartite motif-containing protein 30; metal bind 80.82
2ect_A78 Ring finger protein 126; metal binding protein, st 80.44
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 80.08
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
Probab=97.76  E-value=2.8e-05  Score=50.68  Aligned_cols=54  Identities=24%  Similarity=0.550  Sum_probs=45.9

Q ss_pred             ceecCCCCccc-ccHHHHHhhhhhcCCCCCCcccccccccccc--hhhhhhhhhhcc
Q 028989           43 AMFLCPFCAED-FDIVGLCCHIDEDHPIEAKNGVCPVCAKRVG--TDIVSHITMQHG   96 (200)
Q Consensus        43 ~~F~CPfC~e~-fD~~~Lc~H~~~eH~~e~k~vVCPICa~~v~--~d~v~Hlt~qH~   96 (200)
                      ..|.|+.|++. -....|..|+...|....+.-.|++|.....  .++..|+...|+
T Consensus         9 k~~~C~~C~k~f~~~~~l~~H~~~~H~~~~~~~~C~~C~k~f~~~~~L~~H~~~~H~   65 (66)
T 2drp_A            9 HTYRCKVCSRVYTHISNFCRHYVTSHKRNVKVYPCPFCFKEFTRKDNMTAHVKIIHK   65 (66)
T ss_dssp             TEEECTTTCCEESSHHHHHHHHHHHSSSSCCCEECTTTCCEESCHHHHHHHHHHHTC
T ss_pred             cceECCCCcchhCCHHHHHHHHHHHcCCCCcCeECCCCCCccCCHHHHHHHHHHHcC
Confidence            36999999997 5688899999998876678899999999754  589999988886
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wge_A Hypothetical protein 2610018L09RIK; diphthamide,CSL zinc finger, ADP-ribosylating toxin, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.17.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jr7_A DPH3 homolog; DESR1, CSL zinc finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yop_A KTI11P; zinc finger, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: g.41.17.1 PDB: 1yws_A Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query200
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 93.71
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 92.87
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 92.34
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 91.48
d1wgea170 DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus 91.31
d1wira_121 Protein arginine N-methyltransferase 3 {Mouse (Mus 88.97
d2c2la280 STIP1 homology and U box-containing protein 1, STU 88.93
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 86.8
d1ywsa182 Diphthamide biosynthesis protein 3, DPH3 {Baker's 86.35
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 86.3
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 85.1
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 83.38
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 83.11
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 82.42
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=93.71  E-value=0.033  Score=34.81  Aligned_cols=47  Identities=21%  Similarity=0.452  Sum_probs=37.3

Q ss_pred             eecCCCCccc-ccHHHHHhhhhhcCCCCCCccccccccccc--chhhhhhhhh
Q 028989           44 MFLCPFCAED-FDIVGLCCHIDEDHPIEAKNGVCPVCAKRV--GTDIVSHITM   93 (200)
Q Consensus        44 ~F~CPfC~e~-fD~~~Lc~H~~~eH~~e~k~vVCPICa~~v--~~d~v~Hlt~   93 (200)
                      .|.|. |++. -.-..|..|.. .|.. .++-.|++|....  ..+|..|+++
T Consensus         3 ~y~C~-Cgk~F~~~~~l~~H~~-~Ht~-ekpy~C~~C~k~F~~~~~L~~H~r~   52 (53)
T d2csha1           3 LYPCQ-CGKSFTHKSQRDRHMS-MHLG-LRPYGCGVCGKKFKMKHHLVGHMKI   52 (53)
T ss_dssp             CEECT-TSCEESSHHHHHHHHH-HHSC-CCSEECTTTSCEESSSHHHHHHHTT
T ss_pred             CCCCC-CCCeECCHHHhHHHhh-cccc-ccCCcCCCcCCEecCHHHHHHHHhc
Confidence            58996 9997 77889999976 5654 5778999999974  4689888753
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wgea1 g.41.17.1 (A:8-77) DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywsa1 g.41.17.1 (A:1-82) Diphthamide biosynthesis protein 3, DPH3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure