Citrus Sinensis ID: 028995

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MAAASSCATLALCSSLTSHCKISCQNPNPHPQLSLSKSKLCSFPSPKLYTRPTFSFTHKFSQTEPPPVSEPEVEPEAALEAEAEPTTEVVESAAKEEPKREEIFAVVMIGSRQYIVFPGRFIYTQRLKGANVNDKIILNKVLLVGTKTTTYIGKPVVTNAAVHAVVEEQGLNPKVIVFKYKKKKNYRRNIGHRQVKDLSE
ccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccHHcccccccccccccEEEEEEEccCEEEEccccEEEEEEccccccccEEEEcEEEEEEccccEEEcccEEcccEEEEEEEEcccccEEEEEEccccccccccccccccccccc
*********LALCSSLTSHCKIS******************************************************************************EIFAVVMIGSRQYIVFPGRFIYTQRLKGANVNDKIILNKVLLVGTKTTTYIGKPVVTNAAVHAVVEEQGLNPKVIVFKYKKKKNYRRNIGH********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAASSCATLALCSSLTSHCKISCQNPNPHPQLSLSKSKLCSFPSPKLYTRPTFSFTHKFSQTEPPPVSEPEVEPEAALEAEAEPTTEVVESAAKEEPKREEIFAVVMIGSRQYIVFPGRFIYTQRLKGANVNDKIILNKVLLVGTKTTTYIGKPVVTNAAVHAVVEEQGLNPKVIVFKYKKKKNYRRNIGHRQVKDLSE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L21, chloroplastic This protein binds to 23S ribosomal RNA in the presence of protein L20.probableP51412

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain T
Confidence level:very confident
Coverage over the Query: 103-198
View the alignment between query and template
View the model in PyMOL