Citrus Sinensis ID: 028996

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200

MGKVFASNPLSLNVPDPAFESWLRDSGYLEILDTATTTSANAVTTASTKETTTATTITHSLLHYLYTFISLLTVNPFAKLTTDDFSAKTPSWTREFIGALGSYSFPSSPHTLKLRVHENVKRYARNYASLFILFFACSLYQMPLALVGLISSLALWDFFKFCSDKWNWDRYPVIRQVLVRIAQCGELSNISSLNQNGSRY

ccccccccccccccccHHHHHHHHccccHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccc

******SNPLSLNVPDPAFESWLRDSGYLEILDTA************************SLLHYLYTFISLLTVNPFAKLTTDDFSAKTPSWTREFIGALGSYSFPSSPHTLKLRVHENVKRYARNYASLFILFFACSLYQMPLALVGLISSLALWDFFKFCSDKWNWDRYPVIRQVLVRIAQCGELSNISSLNQN****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
PRA1 family protein H	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.	probable	Q8LFP1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted