Citrus Sinensis ID: 029015


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MDCISSQGELLTHTQTTKFNYRLATSSPKKRAGRRVFRETRHPIFRGVRMRNNNKWVCELREPNKKSRIWLGTYPTPEMAARAHDVAALALRGKSTCLNFADSAWRLPVPASADADDVRKAAAEAAEAFRLSHDDEDQFEENGLLPEKNVFYMDEEAVFDMPGLLVNMAEGLLLSPPPLLIGCEYDDDDDTKWNDYIWGH
cccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEEcccccccEEccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHcccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccc
***************************************TRHPIFRGVRMRNNNKWVCELREPNKKSRIWLGTYPTPEMAARAHDVAALALRGKSTCLNFADSAWRLPV***************************************NVFYMDEEAVFDMPGLLVNMAEGLLLSPPPLLIGCEYDDDDDTKWNDYIWGH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDCISSQGELLTHTQTTKFNYRLATSSPKKRAGRRVFRETRHPIFRGVRMRNNNKWVCELREPNKKSRIWLGTYPTPEMAARAHDVAALALRGKSTCLNFADSAWRLPVPASADADDVRKAAAEAAEAFRLSHDDEDQFEENGLLPEKNVFYMDEEAVFDMPGLLVNMAEGLLLSPPPLLIGCEYDDDDDTKWNDYIWGH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dehydration-responsive element-binding protein 1C Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'. Binding to the C-repeat/DRE element mediates cold-inducible transcription. CBF/DREB1 factors play a key role in freezing tolerance and cold acclimation.probableQ9SYS6
Dehydration-responsive element-binding protein 1F Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'. Binding to the C-repeat/DRE element mediates high salinity- and dehydration-inducible transcription.probableQ8S9Z5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GCC, chain A
Confidence level:confident
Coverage over the Query: 44-103
View the alignment between query and template
View the model in PyMOL