Citrus Sinensis ID: 029036

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MSGDLYSERPLFGGAISSSFPHRFQDVSNIRQVPDHQEVFVDPSRDESLIFELLDFKLDVGDNGSAAWFLQDLATEQDAEGCTLLEQSGVVEAPGLRYKDLPATVTTAVGQMGRQGREAQNIVKVYLANLRLKEVGTDVLVTAYEPLLINPLSESASTVGAGLPVPATQSGFMQMSEVFKLAVSSFKVNDWSLFGGTAAA
ccccccccccccccCEEEcccccccccccccccccccEEEEcccccEEEEEEEEECcccccccHHHHHHHHHHcccccccccEEEECccCECccccccccccEEEEEEEEECcccccccccEEEEEEEEEEcccccccEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHcEEEEcccccccccccc
****LYS**PLFGGAISSSFPHRFQDVSNIRQVPDHQEVFVDPSRDESLIFELLDFKLDVGDNGSAAWFLQDLATEQDAEGCTLLEQSGVVEAPGLRYKDLPATVTTAVGQMGRQGREAQNIVKVYLANLRLKEVGTDVLVTAYEPLLI***************VPATQSGFMQMSEVFKLAVSSFKVNDWSLFGGT***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGDLYSERPLFGGAISSSFPHRFQDVSNIRQVPDHQEVFVDPSRDESLIFELLDFKLDVGDNGSAAWFLQDLATEQDAEGCTLLEQSGVVEAPGLRYKDLPATVTTAVGQMGRQGREAQNIVKVYLANLRLKEVGTDVLVTAYEPLLINPLSESASTVGAGLPVPATQSGFMQMSEVFKLAVSSFKVNDWSLFGGTAAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable ran guanine nucleotide release factor May regulate the intracellular trafficking of ran.probableQ54ML6
Ran guanine nucleotide release factor May regulate the intracellular trafficking of RAN. In cardiac cells seems to regulate the cell surface localization of SCN5A.probableQ9JIB0
Ran guanine nucleotide release factor May regulate the intracellular trafficking of RAN. In cardiac cells seems to regulate the cell surface localization of SCN5A.probableQ9HD47

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EQ6, chain A
Confidence level:very confident
Coverage over the Query: 7-195
View the alignment between query and template
View the model in PyMOL