Citrus Sinensis ID: 029147

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKTGKKVSKAPKIQRLVTPLTLQRKRARIAEKKQRIAKAKAEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAAA
ccccccccccccccccccccEEEEEccccccccccccccccCEECccccccccccccEEEEEEEEcccccccccccccccccccccccHHHHHHcccccccccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
*GGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSPDLSVLNLVIVKKGEHDLP****************SKIRKLFNLSKEDDVRKYVNTYRRTFT***********KIQRLVTPLTLQRKRA******************YQKL**********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKTGKKVSKAPKIQRLVTPLTxxxxxxxxxxxxxxxxxxxxxxxxxxxxLATRLKEQRERRSESLAKKRSRLSAASKPSTAAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
40S ribosomal protein S6 (Fragment) May play an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA.probableP29345
40S ribosomal protein S6-1 May play an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA.probableO48549
40S ribosomal protein S6-2 May play an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA.probableP51430

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U5C, chain G
Confidence level:very confident
Coverage over the Query: 1-170
View the alignment between query and template
View the model in PyMOL