Citrus Sinensis ID: 029173

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MAILRTVATLATATTTTAVAAFAFPSSSSSFSSKSHQPKSQNLSFFSSQSLSLLYSNKSPLVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEGRSTQIFISGLKFLMRLIIFPFMNYFYLFFIHFP
ccEEEEEEEcccccHHHHHHHHHcccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHcccccccEEEEEccccEEEEEEcccHHHHHHHHHHHcccEEEEEcccccccEEEEEcccccccEEEEEEccEEEEEEEccccc
ccHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHEEEEEccccHHHHHHHHHHHHcccccEEEEEEccccEEEEEccccHHHHHHHHHHcccEEEEEcccccccHHHHHHHccHHHHHEEEEcccHHHEEHHHEccc
MAILRTVATLATATTTTAVAafafpsssssfsskshqpksqnlsffssqslsllysnksplvknfsnppsalpmdaptsdhkntsqgdqglpELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKArlvgqgvpegrstQIFISGLKFLMRLIIFPFMNYFYLFFIHFP
MAILRTVATLATATTTTAVAAFAFPSSSSSFSSKSHQPKSQNLSFFSSQSLSLLYSNKSPLVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTgvknvevdlsnqvvrilgssplkTMTEALEQTGRKarlvgqgvpegrsTQIFISGLKFLMRLIIFPFMNYFYLFFIHFP
MAILRtvatlatattttavaafafpsssssfssKSHQPksqnlsffssqslsllysnksPLVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEGRSTQIFISGLKFLMRLIIFPFMNYFYLFFIHFP
***LRTVATLATATTTTAVAAFAF********************************************************************ELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGS******************LVGQGVPEGRSTQIFISGLKFLMRLIIFPFMNYFYLFFIHF*
**ILRTVATLATATTTTAVAAFAF***********************************************************************TEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKAR*****************GLKFLMRLIIFPFMNYFYLFFIHFP
MAILRTVATLATATTTTAVAAFAFP*****************LSFFSSQSLSLLYSNKSPLVKNFSNPPSALPMD************DQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEGRSTQIFISGLKFLMRLIIFPFMNYFYLFFIHFP
****RTVATLATATTTTAVAAFAFP***************************************************************QGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEGRSTQIFISGLKFLMRLIIFPFMNYFYLFFIHFP
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhoooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHi
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAILRTVATLATATTTTAVAAFAFPSSSSSFSSKSHQPKSQNLSFFSSQSLSLLYSNKSPLVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEGRSTQIFISGLKFLMRLIIFPFMNYFYLFFIHFP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query198 2.2.26 [Sep-21-2011]
Q6PWT7 274 Copper chaperone for supe yes no 0.338 0.244 0.447 1e-08
O14618 274 Copper chaperone for supe yes no 0.328 0.237 0.461 2e-08
Q9WU84 274 Copper chaperone for supe yes no 0.328 0.237 0.461 2e-08
Q9JK72 274 Copper chaperone for supe yes no 0.328 0.237 0.461 3e-08
Q75DD6 238 Superoxide dismutase 1 co yes no 0.510 0.424 0.305 2e-07
Q6CIG2 245 Superoxide dismutase 1 co yes no 0.429 0.346 0.279 7e-07
Q6BK66 250 Superoxide dismutase 1 co yes no 0.383 0.304 0.315 2e-06
Q6BZU2 234 Superoxide dismutase 1 co yes no 0.393 0.333 0.320 2e-06
Q6FU61 239 Superoxide dismutase 1 co yes no 0.373 0.309 0.310 2e-05
Q9TT9968 Copper transport protein no no 0.313 0.911 0.380 0.0001
>sp|Q6PWT7|CCS_PIG Copper chaperone for superoxide dismutase OS=Sus scrofa GN=CCS PE=2 SV=1 Back     alignment and function desciption
 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 43/67 (64%)

Query: 95  LTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRK 154
           + E+ V M C+ CVDAV + LQ V G+++VEV L NQ+V +  + P + +   LE TGR+
Sbjct: 13  MLEFAVQMTCQSCVDAVSRSLQGVAGIQSVEVQLENQMVLVQTTLPSQVVQALLEDTGRQ 72

Query: 155 ARLVGQG 161
           A L G G
Sbjct: 73  AVLKGMG 79
Delivers copper to copper zinc superoxide dismutase (SOD1).
Sus scrofa (taxid: 9823)
>sp|O14618|CCS_HUMAN Copper chaperone for superoxide dismutase OS=Homo sapiens GN=CCS PE=1 SV=1 Back     alignment and function description
>sp|Q9WU84|CCS_MOUSE Copper chaperone for superoxide dismutase OS=Mus musculus GN=Ccs PE=1 SV=1 Back     alignment and function description
>sp|Q9JK72|CCS_RAT Copper chaperone for superoxide dismutase OS=Rattus norvegicus GN=Ccs PE=1 SV=1 Back     alignment and function description
>sp|Q75DD6|CCS1_ASHGO Superoxide dismutase 1 copper chaperone OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CCS1 PE=3 SV=1 Back     alignment and function description
>sp|Q6CIG2|CCS1_KLULA Superoxide dismutase 1 copper chaperone OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCS1 PE=3 SV=1 Back     alignment and function description
>sp|Q6BK66|CCS1_DEBHA Superoxide dismutase 1 copper chaperone OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCS1 PE=3 SV=2 Back     alignment and function description
>sp|Q6BZU2|CCS1_YARLI Superoxide dismutase 1 copper chaperone OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCS1 PE=3 SV=1 Back     alignment and function description
>sp|Q6FU61|CCS1_CANGA Superoxide dismutase 1 copper chaperone OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCS1 PE=3 SV=1 Back     alignment and function description
>sp|Q9TT99|ATOX1_CANFA Copper transport protein ATOX1 OS=Canis familiaris GN=ATOX1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
345106302 319 copper/zinc-superoxide dismutase copper 0.611 0.379 0.781 4e-48
344190168 323 Cu/Zn-superoxide dismutase copper chaper 0.631 0.386 0.748 4e-47
255537177 330 superoxide dismutase copper chaperone, p 0.525 0.315 0.790 2e-40
449460453 328 PREDICTED: copper chaperone for superoxi 0.808 0.487 0.6 4e-40
351722110 304 Cu/Zn-superoxide dismutase copper chaper 0.717 0.467 0.597 7e-40
224074743 323 predicted protein [Populus trichocarpa] 0.525 0.321 0.721 6e-38
357476979 312 Cu/Zn-superoxide dismutase copper chaper 0.742 0.471 0.574 1e-37
217073004180 unknown [Medicago truncatula] 0.742 0.816 0.574 2e-37
37654464 312 copper chaperone precursor [Solanum tube 0.621 0.394 0.629 4e-37
256002663 314 copper/zinc superoxide dismutase copper 0.530 0.334 0.722 6e-37
>gi|345106302|gb|AEN71836.1| copper/zinc-superoxide dismutase copper chaperone precursor [Dimocarpus longan] Back     alignment and taxonomy information
 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 109/128 (85%), Gaps = 7/128 (5%)

Query: 37  QPKSQNLSFFSSQSLSLLYSNKSPLVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLT 96
           +P SQNLS FS QSLSL    + PLVKNF+N PSAL MDAPTS+H++  Q    LPELLT
Sbjct: 37  KPPSQNLSVFSPQSLSL----RLPLVKNFTNSPSALHMDAPTSNHQDDHQV---LPELLT 89

Query: 97  EYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKAR 156
           EYMVDMKCEGCV+AVK KLQTV GVKNVEVDLSNQVVRILG SP+KTMTEALEQTGRKAR
Sbjct: 90  EYMVDMKCEGCVNAVKNKLQTVNGVKNVEVDLSNQVVRILGWSPVKTMTEALEQTGRKAR 149

Query: 157 LVGQGVPE 164
           L+GQGVPE
Sbjct: 150 LIGQGVPE 157

Source: Dimocarpus longan

Species: Dimocarpus longan

Genus: Dimocarpus

Family: Sapindaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|344190168|gb|AEM97866.1| Cu/Zn-superoxide dismutase copper chaperone precursor [Corylus heterophylla] Back     alignment and taxonomy information
>gi|255537177|ref|XP_002509655.1| superoxide dismutase copper chaperone, putative [Ricinus communis] gi|223549554|gb|EEF51042.1| superoxide dismutase copper chaperone, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449460453|ref|XP_004147960.1| PREDICTED: copper chaperone for superoxide dismutase-like [Cucumis sativus] gi|449524344|ref|XP_004169183.1| PREDICTED: copper chaperone for superoxide dismutase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|351722110|ref|NP_001235441.1| Cu/Zn-superoxide dismutase copper chaperone [Glycine max] gi|12711645|gb|AAK01931.1|AF329816_1 Cu/Zn-superoxide dismutase copper chaperone precursor [Glycine max] Back     alignment and taxonomy information
>gi|224074743|ref|XP_002304450.1| predicted protein [Populus trichocarpa] gi|222841882|gb|EEE79429.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357476979|ref|XP_003608775.1| Cu/Zn-superoxide dismutase copper chaperone [Medicago truncatula] gi|355509830|gb|AES90972.1| Cu/Zn-superoxide dismutase copper chaperone [Medicago truncatula] gi|388508416|gb|AFK42274.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|217073004|gb|ACJ84862.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|37654464|gb|AAP34306.1| copper chaperone precursor [Solanum tuberosum] Back     alignment and taxonomy information
>gi|256002663|gb|ACU52585.1| copper/zinc superoxide dismutase copper chaperone precursor [Caragana jubata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
TAIR|locus:2034740 320 CCS "AT1G12520" [Arabidopsis t 0.505 0.312 0.644 1.4e-30
UNIPROTKB|Q7XTY9 312 OSJNBa0019K04.8 "Os04g0573200 0.479 0.304 0.591 6.6e-26
UNIPROTKB|F1RUT5178 CCS "Copper chaperone for supe 0.338 0.376 0.447 7.4e-11
UNIPROTKB|Q6PWT7 274 CCS "Copper chaperone for supe 0.338 0.244 0.447 1.5e-10
MGI|MGI:1333783 274 Ccs "copper chaperone for supe 0.388 0.281 0.435 1.5e-10
UNIPROTKB|E9PK03 249 CCS "Copper chaperone for supe 0.383 0.305 0.443 1.7e-10
UNIPROTKB|Q2KHY4216 CCS "Copper chaperone for supe 0.368 0.337 0.432 2e-10
RGD|620403 274 Ccs "copper chaperone for supe 0.388 0.281 0.435 2e-10
UNIPROTKB|O14618 274 CCS "Copper chaperone for supe 0.383 0.277 0.443 2.6e-10
UNIPROTKB|E1BE86 274 CCS "Uncharacterized protein" 0.368 0.266 0.432 4.3e-10
TAIR|locus:2034740 CCS "AT1G12520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 337 (123.7 bits), Expect = 1.4e-30, P = 1.4e-30
 Identities = 67/104 (64%), Positives = 85/104 (81%)

Query:    61 LVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTG 120
             L ++F + P A  +   TSD +N  Q D+ +P+LLTE+MVDM CEGCV+AVK KL+T+ G
Sbjct:    58 LSRSFVSSPMATAL---TSD-RNLHQEDRAMPQLLTEFMVDMTCEGCVNAVKNKLETIEG 113

Query:   121 VKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPE 164
             ++ VEVDLSNQVVRILGSSP+K MT+ALEQTGRKARL+GQGVP+
Sbjct:   114 IEKVEVDLSNQVVRILGSSPVKAMTQALEQTGRKARLIGQGVPQ 157
GO:0005622 "intracellular" evidence=IBA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006801 "superoxide metabolic process" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IBA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0015680 "intracellular copper ion transport" evidence=IBA
GO:0019430 "removal of superoxide radicals" evidence=IBA
GO:0030001 "metal ion transport" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006878 "cellular copper ion homeostasis" evidence=TAS
GO:0016532 "superoxide dismutase copper chaperone activity" evidence=IGI;IMP
GO:0009570 "chloroplast stroma" evidence=IDA
UNIPROTKB|Q7XTY9 OSJNBa0019K04.8 "Os04g0573200 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUT5 CCS "Copper chaperone for superoxide dismutase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q6PWT7 CCS "Copper chaperone for superoxide dismutase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1333783 Ccs "copper chaperone for superoxide dismutase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E9PK03 CCS "Copper chaperone for superoxide dismutase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KHY4 CCS "Copper chaperone for superoxide dismutase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|620403 Ccs "copper chaperone for superoxide dismutase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O14618 CCS "Copper chaperone for superoxide dismutase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BE86 CCS "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
PLN02957 238 PLN02957, PLN02957, copper, zinc superoxide dismut 1e-44
cd0037163 cd00371, HMA, Heavy-metal-associated domain (HMA) 3e-14
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 9e-11
COG260871 COG2608, CopZ, Copper chaperone [Inorganic ion tra 2e-09
PRK10671 834 PRK10671, copA, copper exporting ATPase; Provision 7e-06
TIGR0000366 TIGR00003, TIGR00003, copper ion binding protein 0.004
>gnl|CDD|215516 PLN02957, PLN02957, copper, zinc superoxide dismutase Back     alignment and domain information 
 Score =  147 bits (374), Expect = 1e-44
 Identities = 61/74 (82%), Positives = 67/74 (90%)

Query: 91  LPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQ 150
           LPELLTE+MVDMKCEGCV AVK KL+T+ GVK VEVDLSNQVVR+LGSSP+K MT ALEQ
Sbjct: 3   LPELLTEFMVDMKCEGCVAAVKNKLETLEGVKAVEVDLSNQVVRVLGSSPVKAMTAALEQ 62

Query: 151 TGRKARLVGQGVPE 164
           TGRKARL+GQG PE
Sbjct: 63  TGRKARLIGQGDPE 76

Length = 238
>gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information
>gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional Back     alignment and domain information
>gnl|CDD|188014 TIGR00003, TIGR00003, copper ion binding protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 198
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.34
COG260871 CopZ Copper chaperone [Inorganic ion transport and 99.19
KOG4656 247 consensus Copper chaperone for superoxide dismutas 99.16
KOG160373 consensus Copper chaperone [Inorganic ion transpor 98.78
PLN02957 238 copper, zinc superoxide dismutase 98.49
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 98.41
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 98.38
PRK10671 834 copA copper exporting ATPase; Provisional 98.12
PRK10671 834 copA copper exporting ATPase; Provisional 97.93
TIGR0000368 copper ion binding protein. This model describes a 97.5
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 97.36
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 97.27
TIGR0205292 MerP mercuric transport protein periplasmic compon 93.85
PRK13748 561 putative mercuric reductase; Provisional 92.11
cd0037163 HMA Heavy-metal-associated domain (HMA) is a conse 90.06
PF0120670 TusA: Sulfurtransferase TusA; InterPro: IPR001455 86.31
>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information 
Probab=99.34  E-value=5.7e-12  Score=83.70  Aligned_cols=58  Identities=34%  Similarity=0.688  Sum_probs=53.7

Q ss_pred             Eeec-CCCChhHHHHHHHHHhccCCccEEEEecCCceEEEecC---CCHHHHHHHHHHcCCc
Q 029173           97 EYMV-DMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGS---SPLKTMTEALEQTGRK  154 (198)
Q Consensus        97 ~~~V-Gm~C~~C~~~Ie~~L~~~~GV~~v~vdl~~~~v~V~~~---~~~~~l~~aI~~~G~~  154 (198)
                      +|+| ||+|.+|+.+|++.|.+++||.++.+|+.+++++|.++   .+++++.+.|+++||+
T Consensus         1 t~~v~~m~C~~C~~~v~~~l~~~~GV~~v~vd~~~~~v~v~~~~~~~~~~~i~~~i~~~Gy~   62 (62)
T PF00403_consen    1 TFKVPGMTCEGCAKKVEKALSKLPGVKSVKVDLETKTVTVTYDPDKTSIEKIIEAIEKAGYE   62 (62)
T ss_dssp             EEEEESTTSHHHHHHHHHHHHTSTTEEEEEEETTTTEEEEEESTTTSCHHHHHHHHHHTTSE
T ss_pred             CEEECCcccHHHHHHHHHHHhcCCCCcEEEEECCCCEEEEEEecCCCCHHHHHHHHHHhCcC
Confidence            4889 99999999999999999999999999999999999865   3569999999999995

These proteins provide an important focus for research, some being involved in bacterial resistance to toxic metals, such as lead and cadmium, while others are involved in inherited human syndromes, such as Wilson's and Menke's diseases []. A conserved domain has been found in a number of these heavy metal transport or detoxification proteins []. The domain, which has been termed Heavy-Metal-Associated (HMA), contains two conserved cysteines that are probably involved in metal binding. Structure solution of the fourth HMA domain of the Menke's copper transporting ATPase shows a well-defined structure comprising a four-stranded antiparallel beta-sheet and two alpha helices packed in an alpha-beta sandwich fold []. This fold is common to other domains and is classified as "ferredoxin-like".; GO: 0046872 metal ion binding, 0030001 metal ion transport; PDB: 2VOY_A 1P6T_A 1KQK_A 2RML_A 1JWW_A 3K7R_F 1FES_A 1CC8_A 1FD8_A 2GGP_A ....
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02052 MerP mercuric transport protein periplasmic component Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information
>PF01206 TusA: Sulfurtransferase TusA; InterPro: IPR001455 SirA functions as a response regulator as part of a two-component system, where BarA is the sensor kinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
2crl_A98 The Apo Form Of Hma Domain Of Copper Chaperone For 2e-09
1jk9_B 249 Heterodimer Between H48f-Ysod1 And Yccs Length = 24 1e-05
1qup_A 222 Crystal Structure Of The Copper Chaperone For Super 5e-05
3cjk_A68 Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Le 7e-05
1fe4_A68 Crystal Structure Of Mercury-Hah1 Length = 68 7e-05
>pdb|2CRL|A Chain A, The Apo Form Of Hma Domain Of Copper Chaperone For Superoxide Dismutase Length = 98 Back     alignment and structure 
Iteration: 1

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%)
Query: 97  EYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKAR 156
           E+ V M C+ CVDAV++ LQ V GV++VEV L +Q+V +  + P + +   LE TGR+A 
Sbjct: 22  EFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAV 81
Query: 157 LVGQG 161
           L G G
Sbjct: 82  LKGMG 86
>pdb|1JK9|B Chain B, Heterodimer Between H48f-Ysod1 And Yccs Length = 249 Back     alignment and structure
>pdb|1QUP|A Chain A, Crystal Structure Of The Copper Chaperone For Superoxide Dismutase Length = 222 Back     alignment and structure
>pdb|3CJK|A Chain A, Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Length = 68 Back     alignment and structure
>pdb|1FE4|A Chain A, Crystal Structure Of Mercury-Hah1 Length = 68 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 3e-24
1qup_A 222 Superoxide dismutase 1 copper chaperone; two domai 8e-21
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 2e-19
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 5e-19
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 3e-17
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 2e-12
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 3e-12
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 8e-12
1yg0_A66 COP associated protein; open-faced beta-sandwich, 3e-10
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 2e-08
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 2e-08
2kyz_A67 Heavy metal binding protein; structural genomics, 2e-08
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 5e-07
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 4e-04
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 6e-07
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 5e-05
2kkh_A95 Putative heavy metal transporter; zinc transport, 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 2e-06
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 9e-06
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 2e-05
2l3m_A71 Copper-ION-binding protein; structural genomics, c 2e-05
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 2e-05
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 3e-05
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 3e-05
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 4e-05
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 5e-05
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 4e-05
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 5e-05
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 1e-04
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 1e-04
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 1e-04
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 2e-04
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
 Score = 90.7 bits (225), Expect = 3e-24
 Identities = 31/93 (33%), Positives = 49/93 (52%)

Query: 76  APTSDHKNTSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRI 135
             +      S           E+ V M C+ CVDAV++ LQ V GV++VEV L +Q+V +
Sbjct: 1   GSSGSSGMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLV 60

Query: 136 LGSSPLKTMTEALEQTGRKARLVGQGVPEGRST 168
             + P + +   LE TGR+A L G G  + +++
Sbjct: 61  HTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNS 93
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73 Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Length = 69 Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Length = 67 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Length = 71 Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Length = 72 Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Length = 68 Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Length = 84 Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} Length = 74 Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Length = 71 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.41
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.36
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 99.31
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 99.3
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 99.21
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.21
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 99.2
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 99.19
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 99.13
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 99.13
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 99.13
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 99.12
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 99.1
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 99.1
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 99.1
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 99.1
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 99.1
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 99.08
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 99.08
1yg0_A66 COP associated protein; open-faced beta-sandwich, 99.06
2l3m_A71 Copper-ION-binding protein; structural genomics, c 99.05
2kkh_A95 Putative heavy metal transporter; zinc transport, 99.04
2kyz_A67 Heavy metal binding protein; structural genomics, 99.04
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 99.03
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 99.02
1opz_A76 Potential copper-transporting ATPase; mutation, fo 99.02
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 99.01
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 99.0
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 98.99
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 98.94
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.93
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.89
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.86
1qup_A 222 Superoxide dismutase 1 copper chaperone; two domai 98.85
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.8
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.79
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.76
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 98.7
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 98.59
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.4
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.33
3lvj_C82 Sulfurtransferase TUSA; protein-protein complex, s 86.09
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
Probab=99.41  E-value=9.5e-13  Score=87.50  Aligned_cols=65  Identities=34%  Similarity=0.640  Sum_probs=60.1

Q ss_pred             eEEeecCCCChhHHHHHHHHHhccCCccEEEEecCCceEEEecCCCHHHHHHHHHHcCCceEEcCC
Q 029173           95 LTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQ  160 (198)
Q Consensus        95 ~~~~~VGm~C~~C~~~Ie~~L~~~~GV~~v~vdl~~~~v~V~~~~~~~~l~~aI~~~G~~a~l~~~  160 (198)
                      +.+|.|||+|.+|+.+|+++|.+++|| .+++|+..++++|.+..+++.+.++|++.||.+.+++.
T Consensus         3 ~~~~~vgm~C~~C~~~i~~~l~~~~gV-~v~v~~~~~~~~v~~~~~~~~i~~~i~~~Gy~~~~~~~   67 (68)
T 3iwl_A            3 KHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGL   67 (68)
T ss_dssp             EEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEESSCHHHHHHHHHTTCSCEEEEEC
T ss_pred             eEEEEECcCcHHHHHHHHHHHHcCCCe-EEEEEcCCCEEEEEecCCHHHHHHHHHHcCCceEecCC
Confidence            456777999999999999999999999 99999999999999888999999999999999987753
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>3lvj_C Sulfurtransferase TUSA; protein-protein complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PLP; 2.44A {Escherichia coli} SCOP: d.68.3.3 PDB: 3lvk_B* 1dcj_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 198
d1qupa272 d.58.17.1 (A:2-73) Copper chaperone for superoxide 1e-14
d1fe0a_66 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 2e-14
d1cc8a_72 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 5e-13
d2ggpb172 d.58.17.1 (B:1-72) Copper transporter domain ccc2a 8e-10
d1p6ta279 d.58.17.1 (A:73-151) Potential copper-translocatin 1e-09
d1cpza_68 d.58.17.1 (A:) Copper chaperone {Enterococcus hira 1e-09
d1osda_72 d.58.17.1 (A:) Mercuric ion binding protein MerP { 2e-09
d1mwza_73 d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, 1e-08
d2aw0a_72 d.58.17.1 (A:) Menkes copper-transporting ATPase { 3e-08
d1kvja_79 d.58.17.1 (A:) Menkes copper-transporting ATPase { 3e-08
d2qifa169 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt 4e-08
d1sb6a_64 d.58.17.1 (A:) Copper chaperone {Synechocystis sp. 6e-08
d1p6ta172 d.58.17.1 (A:1-72) Potential copper-translocating 1e-07
d1q8la_84 d.58.17.1 (A:) Menkes copper-transporting ATPase { 2e-07
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone for superoxide dismutase, N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 63.7 bits (155), Expect = 1e-14
 Identities = 18/64 (28%), Positives = 32/64 (50%)

Query: 96  TEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKA 155
             Y + M CE CV+ +K  L+ V G+ ++  D+  Q++ +  S    T+   L   G+ A
Sbjct: 8   ATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDA 67

Query: 156 RLVG 159
            + G
Sbjct: 68  IIRG 71
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.57
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.57
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.5
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.5
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.49
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.48
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.46
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.45
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.45
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.44
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.42
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.4
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.4
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 99.39
d1dcja_81 SirA {Escherichia coli [TaxId: 562]} 84.68
d1jdqa_98 Hypothetical protein TM0983 {Thermotoga maritima [ 82.23
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: ATX1 metallochaperone protein (ATOX1)
species: Human (Homo sapiens), HAH1 [TaxId: 9606]

Probab=99.57  E-value=3.6e-15  Score=98.57  Aligned_cols=64  Identities=34%  Similarity=0.659  Sum_probs=60.8

Q ss_pred             eEEeecCCCChhHHHHHHHHHhccCCccEEEEecCCceEEEecCCCHHHHHHHHHHcCCceEEcC
Q 029173           95 LTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVG  159 (198)
Q Consensus        95 ~~~~~VGm~C~~C~~~Ie~~L~~~~GV~~v~vdl~~~~v~V~~~~~~~~l~~aI~~~G~~a~l~~  159 (198)
                      +++|+|+|+|.+|+.+|+++|++++|+ ++++|+..++++|.++.+++.+.++|+++||.+++++
T Consensus         2 k~ef~V~M~C~~C~~~I~~aL~~~~gv-~v~v~~~~~~v~V~~~~~~~~i~~~I~~~Gy~a~lig   65 (66)
T d1fe0a_           2 KHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLG   65 (66)
T ss_dssp             EEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEESSCHHHHHHHHHTTTSCEEEEE
T ss_pred             CEEEEEccCchHHHHHHHHHHhcCCCc-EEEEEcCCCEEEEEeeCCHHHHHHHHHHhCCeEEEee
Confidence            578999999999999999999999998 5999999999999999999999999999999999875
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcja_ d.68.3.3 (A:) SirA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jdqa_ d.68.3.3 (A:) Hypothetical protein TM0983 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure