Citrus Sinensis ID: 029203


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MSTPATPSPNYLTNIGLGYSIAIALGFLVLLSTVLLASYICCRRNNSSHNSNANPHENNNSVSNDGIILPRIIFVAEDDGQEENRNQDDDNLVVGLDQAVINSYPKFQFTKESVSGNNNSNNINTTCSICLCEYKDLEMLRMMPECRHYFHLCCVDAWLKLNGSCPVCRNSPLPTPLSTPLQEVVPLSQYAADRRRR
cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccEEEEccccccccccccccccccEEccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccHcccc
**********YLTNIGLGYSIAIALGFLVLLSTVLLASYICCRRNNS*******************IILPRIIFVA***************LVVGLDQAVINSYPKFQFTKE*******SNNINTTCSICLCEYKDLEMLRMMPECRHYFHLCCVDAWLKLNGSCPVCRNSP*************************
xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTPATPSPNYLTNIGLGYSIAIALGFLVLLSTVLLASYICCRRNNSSHNSNANPHENNNSVSNDGIILPRIIFVAEDDGQEENRNQDDDNLVVGLDQAVINSYPKFQFTKESVSGNNNSNNINTTCSICLCEYKDLEMLRMMPECRHYFHLCCVDAWLKLNGSCPVCRNSPLPTPLSTPLQEVVPLSQYAADRRRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RING-H2 finger protein ATL68 probableQ9M313

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0B, chain A
Confidence level:very confident
Coverage over the Query: 88-174
View the alignment between query and template
View the model in PyMOL
Template: 2JWA, chain A
Confidence level:probable
Coverage over the Query: 15-46
View the alignment between query and template
View the model in PyMOL
Template: 4EPO, chain C
Confidence level:probable
Coverage over the Query: 126-196
View the alignment between query and template
View the model in PyMOL