Citrus Sinensis ID: 029203
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 197 | ||||||
| 224127780 | 205 | predicted protein [Populus trichocarpa] | 0.974 | 0.936 | 0.709 | 2e-70 | |
| 147832281 | 641 | hypothetical protein VITISV_040608 [Viti | 0.873 | 0.268 | 0.670 | 3e-65 | |
| 297745339 | 279 | unnamed protein product [Vitis vinifera] | 0.873 | 0.616 | 0.670 | 3e-65 | |
| 224064077 | 171 | predicted protein [Populus trichocarpa] | 0.802 | 0.923 | 0.640 | 4e-61 | |
| 15233144 | 212 | RING-H2 finger protein ATL68 [Arabidopsi | 0.918 | 0.853 | 0.629 | 1e-60 | |
| 297817474 | 211 | zinc finger family protein [Arabidopsis | 0.918 | 0.857 | 0.614 | 2e-59 | |
| 87162786 | 179 | Zinc finger, RING-type [Medicago truncat | 0.903 | 0.994 | 0.619 | 5e-59 | |
| 357507627 | 298 | Ring finger protein [Medicago truncatula | 0.903 | 0.597 | 0.619 | 6e-59 | |
| 356531933 | 184 | PREDICTED: RING-H2 finger protein ATL68- | 0.873 | 0.934 | 0.668 | 8e-58 | |
| 15225932 | 214 | RING-H2 finger protein ATL67 [Arabidopsi | 0.873 | 0.803 | 0.652 | 7e-56 |
| >gi|224127780|ref|XP_002320162.1| predicted protein [Populus trichocarpa] gi|222860935|gb|EEE98477.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 271 bits (692), Expect = 2e-70, Method: Compositional matrix adjust.
Identities = 139/196 (70%), Positives = 159/196 (81%), Gaps = 4/196 (2%)
Query: 2 STPATPSPNYLTNIGLGYSIAIALGFLVLLSTVLLASYICCRRNNSSHNSNANPHENNNS 61
+T P NYLTN+GLGYSIAIAL FLVLLST+LLASYICCR N ++ N + N +
Sbjct: 14 ATSPPPPANYLTNLGLGYSIAIALFFLVLLSTILLASYICCRTNRHRSRNSNNNNNNYAN 73
Query: 62 VSNDGIILPRIIFVAEDDGQEENRNQDDDNLVVGLDQAVINSYPKFQFTKESVSGNNNSN 121
+ DGIILPRIIFVAEDD ++E +D ++ VGL+QAVINSYPKFQF+K+ + +N
Sbjct: 74 STADGIILPRIIFVAEDDEEQE---RDLESAAVGLNQAVINSYPKFQFSKDG-GFSERTN 129
Query: 122 NINTTCSICLCEYKDLEMLRMMPECRHYFHLCCVDAWLKLNGSCPVCRNSPLPTPLSTPL 181
N TCSICLCEYKDLEMLRMMP+CRHYFHL C+DAWLKLNGSCPVCRNSPLPTPLSTPL
Sbjct: 130 NFCNTCSICLCEYKDLEMLRMMPDCRHYFHLLCLDAWLKLNGSCPVCRNSPLPTPLSTPL 189
Query: 182 QEVVPLSQYAADRRRR 197
EVVPLSQYAADRRRR
Sbjct: 190 SEVVPLSQYAADRRRR 205
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147832281|emb|CAN73279.1| hypothetical protein VITISV_040608 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297745339|emb|CBI40419.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224064077|ref|XP_002301380.1| predicted protein [Populus trichocarpa] gi|222843106|gb|EEE80653.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|15233144|ref|NP_191714.1| RING-H2 finger protein ATL68 [Arabidopsis thaliana] gi|68565321|sp|Q9M313.1|ATL68_ARATH RecName: Full=RING-H2 finger protein ATL68 gi|16226239|gb|AAL16112.1|AF428280_1 AT3g61550/F2A19_150 [Arabidopsis thaliana] gi|6850846|emb|CAB71085.1| putative protein [Arabidopsis thaliana] gi|21436049|gb|AAM51602.1| AT3g61550/F2A19_150 [Arabidopsis thaliana] gi|62320670|dbj|BAD95337.1| hypothetical protein [Arabidopsis thaliana] gi|332646700|gb|AEE80221.1| RING-H2 finger protein ATL68 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297817474|ref|XP_002876620.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297322458|gb|EFH52879.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|87162786|gb|ABD28581.1| Zinc finger, RING-type [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357507627|ref|XP_003624102.1| Ring finger protein [Medicago truncatula] gi|355499117|gb|AES80320.1| Ring finger protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356531933|ref|XP_003534530.1| PREDICTED: RING-H2 finger protein ATL68-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15225932|ref|NP_182139.1| RING-H2 finger protein ATL67 [Arabidopsis thaliana] gi|68565091|sp|O82353.1|ATL67_ARATH RecName: Full=RING-H2 finger protein ATL67 gi|3702333|gb|AAC62890.1| hypothetical protein [Arabidopsis thaliana] gi|18491265|gb|AAL69457.1| At2g46160/T3F17.19 [Arabidopsis thaliana] gi|330255556|gb|AEC10650.1| RING-H2 finger protein ATL67 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 197 | ||||||
| TAIR|locus:2062892 | 214 | AT2G46160 [Arabidopsis thalian | 0.944 | 0.869 | 0.482 | 3.2e-42 | |
| TAIR|locus:2082762 | 212 | AT3G61550 [Arabidopsis thalian | 0.949 | 0.882 | 0.472 | 1.4e-41 | |
| TAIR|locus:2169399 | 159 | AT5G07040 [Arabidopsis thalian | 0.461 | 0.572 | 0.336 | 1.1e-15 | |
| TAIR|locus:2144088 | 197 | AT5G06490 [Arabidopsis thalian | 0.903 | 0.903 | 0.281 | 6.9e-15 | |
| TAIR|locus:2039170 | 217 | AT2G35910 [Arabidopsis thalian | 0.497 | 0.451 | 0.390 | 3.8e-14 | |
| TAIR|locus:2044742 | 302 | AT2G34990 [Arabidopsis thalian | 0.365 | 0.238 | 0.430 | 7.3e-12 | |
| TAIR|locus:2010489 | 299 | AT1G28040 [Arabidopsis thalian | 0.411 | 0.270 | 0.406 | 9.2e-12 | |
| TAIR|locus:2173772 | 376 | AT5G40250 [Arabidopsis thalian | 0.375 | 0.196 | 0.4 | 3.9e-11 | |
| TAIR|locus:2140069 | 323 | AT4G40070 [Arabidopsis thalian | 0.507 | 0.309 | 0.351 | 4.3e-11 | |
| TAIR|locus:2040085 | 377 | AT2G25410 [Arabidopsis thalian | 0.375 | 0.196 | 0.415 | 6.5e-11 |
| TAIR|locus:2062892 AT2G46160 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 447 (162.4 bits), Expect = 3.2e-42, P = 3.2e-42
Identities = 97/201 (48%), Positives = 112/201 (55%)
Query: 2 STPATPSPNYLTNIGLGYSIAIXXXXXXXXXXXXXXXYICCRRXXXXXXXXXXXXXXXXX 61
S P + +YLT +G GYSIAI YICCR
Sbjct: 20 SPPQAGNHSYLTTLGFGYSIAIALGFLVLLSTVLLSSYICCR-----DSRRRTTAVESTG 74
Query: 62 XXXDGIILPRIIFVAEDDGQEENRNQDDDNLVVGLDQAVINSYPKFQFTKES--VSGXXX 119
+ILPRIIFVAE+D N + + ++VVGLDQAVINSYPKF F+K++ S
Sbjct: 75 DRGGSVILPRIIFVAEED----NEDLEAGDVVVGLDQAVINSYPKFHFSKDTSAASSDGF 130
Query: 120 XXXXXXXXXXXLCEYKDLEMLRMMPECRHYFHLCCVDAWLKLNGSCPVCRNXX----XXX 175
LCEYK+ EMLRMMPEC+HYFHLCC+DAWLKLNGSCPVCRN
Sbjct: 131 GGGGDTTCSICLCEYKEAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCRNSPLPTPTST 190
Query: 176 XXXXXXQEVVPLSQYAADRRR 196
EVVPLSQYAADRRR
Sbjct: 191 PLSTPLSEVVPLSQYAADRRR 211
|
|
| TAIR|locus:2082762 AT3G61550 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2169399 AT5G07040 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2144088 AT5G06490 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2039170 AT2G35910 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044742 AT2G34990 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2010489 AT1G28040 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173772 AT5G40250 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2140069 AT4G40070 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040085 AT2G25410 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 197 | |||
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 1e-12 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 2e-09 | |
| pfam12678 | 73 | pfam12678, zf-rbx1, RING-H2 zinc finger | 2e-08 | |
| COG5540 | 374 | COG5540, COG5540, RING-finger-containing ubiquitin | 2e-06 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 1e-05 | |
| PHA02929 | 238 | PHA02929, PHA02929, N1R/p28-like protein; Provisio | 2e-05 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 5e-05 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 8e-04 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 0.002 | |
| COG5194 | 88 | COG5194, APC11, Component of SCF ubiquitin ligase | 0.004 |
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
Score = 59.3 bits (144), Expect = 1e-12
Identities = 19/44 (43%), Positives = 29/44 (65%), Gaps = 1/44 (2%)
Query: 126 TCSICLCEYKDLEMLRMMPECRHYFHLCCVDAWLKLNGSCPVCR 169
C ICL E++ E + ++P C H FH C+D WL+ + +CP+CR
Sbjct: 2 ECPICLDEFEPGEEVVVLP-CGHVFHKECLDKWLRSSNTCPLCR 44
|
Length = 46 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 197 | |||
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.85 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.68 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 99.52 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 99.5 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 99.48 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 99.29 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 99.22 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 99.21 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.2 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 99.18 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 99.14 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.08 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 99.07 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.06 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 99.03 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 99.0 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 99.0 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.99 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.93 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.89 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.87 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.78 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 98.77 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 98.65 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.62 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.61 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 98.59 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 98.57 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.48 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.4 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 98.39 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.33 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.3 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.26 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 98.2 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 98.18 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.16 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.16 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 98.15 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 98.13 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 98.08 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.08 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 98.01 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 97.98 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.97 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.93 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.89 | |
| KOG0801 | 205 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.75 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.7 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.68 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.64 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.58 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 97.47 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 97.44 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 97.42 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.39 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.38 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 97.38 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 97.34 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 97.2 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.93 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 96.89 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 96.87 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 96.85 | |
| PHA02862 | 156 | 5L protein; Provisional | 96.74 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 96.72 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 96.7 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 96.7 | |
| PHA03096 | 284 | p28-like protein; Provisional | 96.59 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.5 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 96.39 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 96.37 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 96.13 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.04 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 96.03 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.75 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.7 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 95.69 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 95.58 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 95.32 | |
| PF15102 | 146 | TMEM154: TMEM154 protein family | 95.25 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 94.84 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 94.71 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 94.64 | |
| KOG3268 | 234 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.47 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 94.43 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.41 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 94.27 | |
| PF01102 | 122 | Glycophorin_A: Glycophorin A; InterPro: IPR001195 | 94.16 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.12 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 93.99 | |
| PF12273 | 130 | RCR: Chitin synthesis regulation, resistance to Co | 93.91 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.77 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 93.65 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 93.39 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 93.38 | |
| COG5183 | 1175 | SSM4 Protein involved in mRNA turnover and stabili | 93.31 | |
| KOG3053 | 293 | consensus Uncharacterized conserved protein [Funct | 93.23 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 92.89 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.04 | |
| PF05568 | 189 | ASFV_J13L: African swine fever virus J13L protein; | 92.02 | |
| PF02439 | 38 | Adeno_E3_CR2: Adenovirus E3 region protein CR2; In | 91.99 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 91.99 | |
| KOG1609 | 323 | consensus Protein involved in mRNA turnover and st | 91.93 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 91.89 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.87 | |
| PF13908 | 179 | Shisa: Wnt and FGF inhibitory regulator | 91.17 | |
| PF08693 | 40 | SKG6: Transmembrane alpha-helix domain; InterPro: | 90.99 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 90.8 | |
| PHA02650 | 81 | hypothetical protein; Provisional | 90.73 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 90.42 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.32 | |
| PHA02844 | 75 | putative transmembrane protein; Provisional | 90.23 | |
| PF06024 | 101 | DUF912: Nucleopolyhedrovirus protein of unknown fu | 90.09 | |
| KOG3899 | 381 | consensus Uncharacterized conserved protein [Funct | 89.79 | |
| PHA02819 | 71 | hypothetical protein; Provisional | 88.84 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 87.86 | |
| PF15176 | 102 | LRR19-TM: Leucine-rich repeat family 19 TM domain | 87.61 | |
| PF02480 | 439 | Herpes_gE: Alphaherpesvirus glycoprotein E; InterP | 87.46 | |
| PF04478 | 154 | Mid2: Mid2 like cell wall stress sensor; InterPro: | 87.4 | |
| PF07010 | 259 | Endomucin: Endomucin; InterPro: IPR010740 This fam | 86.62 | |
| PF07975 | 51 | C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al | 86.56 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 86.55 | |
| PF12273 | 130 | RCR: Chitin synthesis regulation, resistance to Co | 85.94 | |
| PHA03054 | 72 | IMV membrane protein; Provisional | 85.1 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 84.42 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 84.3 | |
| PTZ00370 | 296 | STEVOR; Provisional | 84.2 | |
| PF13901 | 202 | DUF4206: Domain of unknown function (DUF4206) | 84.0 | |
| KOG0269 | 839 | consensus WD40 repeat-containing protein [Function | 83.2 | |
| KOG1829 | 580 | consensus Uncharacterized conserved protein, conta | 82.93 | |
| TIGR00622 | 112 | ssl1 transcription factor ssl1. This family is bas | 82.9 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 82.84 | |
| KOG3005 | 276 | consensus GIY-YIG type nuclease [General function | 82.78 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 81.94 | |
| PHA02975 | 69 | hypothetical protein; Provisional | 81.51 | |
| PF06365 | 202 | CD34_antigen: CD34/Podocalyxin family; InterPro: I | 81.38 | |
| KOG4718 | 235 | consensus Non-SMC (structural maintenance of chrom | 81.25 | |
| PF02060 | 129 | ISK_Channel: Slow voltage-gated potassium channel; | 81.07 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 80.93 | |
| KOG1100 | 207 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.9 | |
| PF14575 | 75 | EphA2_TM: Ephrin type-A receptor 2 transmembrane d | 80.51 | |
| PF13209 | 60 | DUF4017: Protein of unknown function (DUF4017) | 80.05 |
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.85 E-value=1.6e-21 Score=166.20 Aligned_cols=85 Identities=35% Similarity=0.772 Sum_probs=68.6
Q ss_pred CCCHHHHhcCCCeeeccccccCCCCCCCCCCccccccccccCCcceeecCCCCCccchhhHHHHhhCCCC-CcccCCCCC
Q 029203 95 GLDQAVINSYPKFQFTKESVSGNNNSNNINTTCSICLCEYKDLEMLRMMPECRHYFHLCCVDAWLKLNGS-CPVCRNSPL 173 (197)
Q Consensus 95 ~l~~~~~~~lp~~~~~~~~~~~~~~~~~~~~~CaICL~~~~~~~~vr~l~~C~H~FH~~CI~~Wl~~~~t-CPlCR~~l~ 173 (197)
.+.+..++++|...|.+.... .. ...|+||||+|++||++|.|| |+|.||..|||+||..+.+ ||+||.++.
T Consensus 206 r~~k~~l~~~p~~~f~~~~~~-----~~-~~~CaIClEdY~~GdklRiLP-C~H~FH~~CIDpWL~~~r~~CPvCK~di~ 278 (348)
T KOG4628|consen 206 RLIKRLLKKLPVRTFTKGDDE-----DA-TDTCAICLEDYEKGDKLRILP-CSHKFHVNCIDPWLTQTRTFCPVCKRDIR 278 (348)
T ss_pred hhHHHHHhhCCcEEecccccc-----CC-CceEEEeecccccCCeeeEec-CCCchhhccchhhHhhcCccCCCCCCcCC
Confidence 477889999999999877431 12 279999999999999999999 9999999999999988765 999999886
Q ss_pred CCCCCCCCccccc
Q 029203 174 PTPLSTPLQEVVP 186 (197)
Q Consensus 174 ~~~~~~~~~~~~~ 186 (197)
.......-.|-+|
T Consensus 279 ~~~~~~~~~e~tp 291 (348)
T KOG4628|consen 279 TDSGSEPVSEDTP 291 (348)
T ss_pred CCCCCCCccCCCc
Confidence 6544444344333
|
|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >PF15102 TMEM154: TMEM154 protein family | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >PF12273 RCR: Chitin synthesis regulation, resistance to Congo red; InterPro: IPR020999 RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3053 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05568 ASFV_J13L: African swine fever virus J13L protein; InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ] | Back alignment and domain information |
|---|
| >PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13908 Shisa: Wnt and FGF inhibitory regulator | Back alignment and domain information |
|---|
| >PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PHA02650 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02844 putative transmembrane protein; Provisional | Back alignment and domain information |
|---|
| >PF06024 DUF912: Nucleopolyhedrovirus protein of unknown function (DUF912); InterPro: IPR009261 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf78; it is a family of uncharacterised viral proteins | Back alignment and domain information |
|---|
| >KOG3899 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA02819 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF15176 LRR19-TM: Leucine-rich repeat family 19 TM domain | Back alignment and domain information |
|---|
| >PF02480 Herpes_gE: Alphaherpesvirus glycoprotein E; InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein | Back alignment and domain information |
|---|
| >PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region | Back alignment and domain information |
|---|
| >PF07010 Endomucin: Endomucin; InterPro: IPR010740 This family consists of several mammalian endomucin proteins | Back alignment and domain information |
|---|
| >PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12273 RCR: Chitin synthesis regulation, resistance to Congo red; InterPro: IPR020999 RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls | Back alignment and domain information |
|---|
| >PHA03054 IMV membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00370 STEVOR; Provisional | Back alignment and domain information |
|---|
| >PF13901 DUF4206: Domain of unknown function (DUF4206) | Back alignment and domain information |
|---|
| >KOG0269 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00622 ssl1 transcription factor ssl1 | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG3005 consensus GIY-YIG type nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PHA02975 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF06365 CD34_antigen: CD34/Podocalyxin family; InterPro: IPR013836 This family consists of several mammalian CD34 antigen proteins | Back alignment and domain information |
|---|
| >KOG4718 consensus Non-SMC (structural maintenance of chromosomes) element 1 protein (NSE1) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF02060 ISK_Channel: Slow voltage-gated potassium channel; InterPro: IPR000369 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14575 EphA2_TM: Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A | Back alignment and domain information |
|---|
| >PF13209 DUF4017: Protein of unknown function (DUF4017) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 197 | ||||
| 1x4j_A | 75 | Solution Structure Of Ring Finger In Ring Finger Pr | 1e-06 | ||
| 1iym_A | 55 | Ring-H2 Finger Domain Of El5 Length = 55 | 2e-05 | ||
| 2l0b_A | 91 | Solution Nmr Structure Of Zinc Finger Domain Of E3 | 6e-04 |
| >pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 | Back alignment and structure |
|
| >pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 | Back alignment and structure |
| >pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 197 | |||
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 1e-28 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 3e-27 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 2e-22 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 1e-20 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 3e-20 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 3e-18 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 2e-17 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 6e-16 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 2e-12 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 5e-12 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 2e-11 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 5e-11 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 2e-10 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 7e-10 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 3e-09 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 2e-08 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 5e-08 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 2e-05 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 6e-07 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 7e-07 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 3e-06 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 4e-06 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 5e-06 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 7e-06 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 8e-06 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 9e-06 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 1e-05 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 2e-05 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 2e-05 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 3e-05 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 3e-05 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 4e-05 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 1e-04 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 1e-04 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 1e-04 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 2e-04 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 2e-04 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 3e-04 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 3e-04 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 5e-04 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 5e-04 |
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
Score = 100 bits (252), Expect = 1e-28
Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 7/79 (8%)
Query: 98 QAVINSYPKFQFTKESVSGNNNSNNINTTCSICLCEYKDLEMLRMMPECRHYFHLCCVDA 157
P ++F + T C +C+C+++ ++LR++P C H FH CVD
Sbjct: 3 SGSSGQLPSYRFNPNNHQSEQ------TLCVVCMCDFESRQLLRVLP-CNHEFHAKCVDK 55
Query: 158 WLKLNGSCPVCRNSPLPTP 176
WLK N +CP+CR P+
Sbjct: 56 WLKANRTCPICRADSGPSS 74
|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 197 | |||
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.81 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.75 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.7 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.69 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.67 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.66 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.64 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.6 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.58 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.58 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 99.57 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.56 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.56 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.54 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.5 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.49 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.49 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.48 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 99.47 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.46 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.41 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.41 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.41 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.4 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.4 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 99.39 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.37 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.36 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.35 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.35 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.35 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.33 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.33 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.32 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.32 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.3 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.3 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.28 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.28 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.26 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.25 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.25 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.18 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.15 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.14 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.13 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.13 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 99.12 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.12 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 99.1 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.09 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 99.09 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 99.07 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 99.07 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.06 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 99.05 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 99.04 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.98 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.92 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.89 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.87 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.85 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.85 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.79 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.76 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.69 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.62 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.59 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.57 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.47 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 98.26 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 98.21 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 96.84 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 95.41 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 95.13 | |
| 2k1k_A | 38 | Ephrin type-A receptor 1; EPHA1, receptor tyrosine | 94.51 | |
| 2jwa_A | 44 | Receptor tyrosine-protein kinase ERBB-2; transmemb | 94.22 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 93.29 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 93.12 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 92.6 | |
| 2k9y_A | 41 | Ephrin type-A receptor 2; receptor tyrosine kinase | 92.49 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 92.41 | |
| 2l2t_A | 44 | Receptor tyrosine-protein kinase ERBB-4; transmemb | 92.06 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 91.67 | |
| 2klu_A | 70 | T-cell surface glycoprotein CD4; cell membrane, di | 91.24 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 91.24 | |
| 2ks1_B | 44 | Epidermal growth factor receptor; ERBB1, ERBB2, tr | 90.93 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 90.9 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 90.85 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 89.54 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 89.29 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 89.2 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 88.87 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 88.82 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 88.72 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 88.12 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 88.06 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 87.68 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 87.02 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 86.27 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 86.06 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 85.83 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 84.26 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 83.99 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 83.85 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 83.78 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 83.68 | |
| 1iij_A | 35 | ERBB-2 receptor protein-tyrosine kinase; alpha-hel | 83.21 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 83.11 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 83.03 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 82.92 | |
| 1y02_A | 120 | CARP2, FYVE-ring finger protein sakura; zinc-bindi | 82.75 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 81.21 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 81.18 | |
| 2yw8_A | 82 | RUN and FYVE domain-containing protein 1; structur | 81.13 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 80.86 | |
| 1wfk_A | 88 | Zinc finger, FYVE domain containing 19; riken stru | 80.85 | |
| 1z2q_A | 84 | LM5-1; membrane protein, FYVE domain, zinc-finger; | 80.71 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 80.43 |
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.81 E-value=3.9e-20 Score=129.84 Aligned_cols=81 Identities=31% Similarity=0.656 Sum_probs=70.1
Q ss_pred CCCCcCCCCCHHHHhcCCCeeeccccccCCCCCCCCCCccccccccccCCcceeecCCCCCccchhhHHHHhhCCCCCcc
Q 029203 88 DDDNLVVGLDQAVINSYPKFQFTKESVSGNNNSNNINTTCSICLCEYKDLEMLRMMPECRHYFHLCCVDAWLKLNGSCPV 167 (197)
Q Consensus 88 ~~~~~~~~l~~~~~~~lp~~~~~~~~~~~~~~~~~~~~~CaICL~~~~~~~~vr~l~~C~H~FH~~CI~~Wl~~~~tCPl 167 (197)
.......+++++.++.+|.+.+..... .......|+|||++|..++.++.++ |+|.||..||+.|+..+.+||+
T Consensus 9 ~~~~~~~~~s~~~i~~lp~~~~~~~~~-----~~~~~~~C~IC~~~~~~~~~~~~l~-C~H~Fh~~Ci~~wl~~~~~CP~ 82 (91)
T 2l0b_A 9 SHMVANPPASKESIDALPEILVTEDHG-----AVGQEMCCPICCSEYVKGDVATELP-CHHYFHKPCVSIWLQKSGTCPV 82 (91)
T ss_dssp CCSSCCCCCCHHHHHTSCEEECCTTCS-----SSSSCSEETTTTEECCTTCEEEEET-TTEEEEHHHHHHHHTTTCBCTT
T ss_pred CCCcCCCCCCHHHHHhCCCeeeccccc-----ccCCCCCCcccChhhcCCCcEEecC-CCChHHHHHHHHHHHcCCcCcC
Confidence 444567899999999999988876532 3456789999999999999999999 9999999999999999999999
Q ss_pred cCCCCCC
Q 029203 168 CRNSPLP 174 (197)
Q Consensus 168 CR~~l~~ 174 (197)
||..+.+
T Consensus 83 Cr~~~~~ 89 (91)
T 2l0b_A 83 CRCMFPP 89 (91)
T ss_dssp TCCBSSC
T ss_pred cCccCCC
Confidence 9998754
|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A | Back alignment and structure |
|---|
| >2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k9y_A Ephrin type-A receptor 2; receptor tyrosine kinase, membrane protein, dimeric transmembrane domain, ephrin receptor, ATP-binding, glycoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2klu_A T-cell surface glycoprotein CD4; cell membrane, disulfide bond, HOST- virus interaction, immune response, immunoglobulin domain, lipoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1iij_A ERBB-2 receptor protein-tyrosine kinase; alpha-helix-PI-bulge-alpha-helix, signaling protein; NMR {Synthetic} SCOP: j.35.1.1 | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 197 | ||||
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 2e-16 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 2e-11 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 1e-09 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 4e-09 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 4e-08 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 5e-08 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 6e-08 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 7e-08 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 3e-06 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 1e-05 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 2e-05 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 3e-05 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 0.002 |
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: EL5 RING-H2 domain species: Rice (Oryza sativa) [TaxId: 4530]
Score = 67.6 bits (165), Expect = 2e-16
Identities = 21/48 (43%), Positives = 29/48 (60%)
Query: 124 NTTCSICLCEYKDLEMLRMMPECRHYFHLCCVDAWLKLNGSCPVCRNS 171
C++CL E +D E R +P C H FH CVD WL + +CP+CR +
Sbjct: 5 GVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLT 52
|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 197 | |||
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.82 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.63 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.6 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.59 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.58 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.53 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.5 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.43 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.35 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.34 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.34 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 99.27 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.2 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.08 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.07 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.95 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.78 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 95.35 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 94.82 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 93.89 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 93.17 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 91.56 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 89.54 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 89.36 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 88.68 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 86.64 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 86.19 | |
| d1y02a2 | 51 | Rififylin (FYVE-RING finger protein Sakura) {Human | 86.01 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 85.26 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 85.15 | |
| d1z60a1 | 59 | TFIIH p44 subunit cysteine-rich domain {Human (Hom | 83.98 |
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: EL5 RING-H2 domain species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.82 E-value=3.8e-21 Score=121.36 Aligned_cols=52 Identities=40% Similarity=0.941 Sum_probs=47.6
Q ss_pred CCCCccccccccccCCcceeecCCCCCccchhhHHHHhhCCCCCcccCCCCC
Q 029203 122 NINTTCSICLCEYKDLEMLRMMPECRHYFHLCCVDAWLKLNGSCPVCRNSPL 173 (197)
Q Consensus 122 ~~~~~CaICL~~~~~~~~vr~l~~C~H~FH~~CI~~Wl~~~~tCPlCR~~l~ 173 (197)
+++.+|+|||++|.+++.++.++.|+|.||..||.+|++.+.+||+||++|+
T Consensus 3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~ 54 (55)
T d1iyma_ 3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 54 (55)
T ss_dssp CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence 3457899999999999999888779999999999999999999999999885
|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|