Citrus Sinensis ID: 029207


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLADNKVSEDGFLVVMLSKSKTLGSAGASSAQPAHTTPPTTAPSSNSTPPQEASVPPPAPTPSIPASNVTSNVTAANANSDTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRALQAAYNNPERAVDYLYSISSL
cEEEEEcccccEEEEEEccccHHHHHHHHHHHHccccccccccEEEEEccccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHccccc
cEEEEEEccccEEEEEEccHHHHHHHHHHHHHHcccccccHHHcHEEEcccEEcccccHHHcccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHcHccc
mkltvktlkgshfeirvqpsDTVMAVKKNIedvqgkdnypcgqqllihngkvlkdettladnkvseDGFLVVMLSKsktlgsagassaqpahttppttapssnstppqeasvpppaptpsipasnvtsnvtaanansdtygqaasnlvagndLEQTIQQIMDmgggtwdkETVTRALQAAYNNPERAVDYLYSISSL
mkltvktlkgshfeirvqpsdtvMAVKKNIEdvqgkdnyPCGQQLLIHNGKVLKDETTLADNKVSEDGFLVVMLSKSKTLGSAgassaqpahtTPPTTAPSSNSTPPQEASVPPPAPTPSIPASNVTSNVTAANANSDTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRALQAaynnperavDYLYSISSL
MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLADNKVSEDGFLVVMLSKSKTLGSAGassaqpahttppttapssnstppqeasvpppaptpsipasnvtsnvtaanansDTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRALQAAYNNPERAVDYLYSISSL
**************I******TVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLADNKVSEDGFLVVML************************************************************************LVAGNDLEQTIQQIMDMGGGTWDKETVTRALQAAYNNPERAVDYLY*****
MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLADNKVSEDGFLVVM***********************************************************************************I*QIMDMGGGTWDKETVTRALQAAYNNPERAVDYLYSISS*
MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLADNKVSEDGFLVVMLSKSK****************************************PSIPASNVTSNVTAANANSDTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRALQAAYNNPERAVDYLYSISSL
MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLADNKVSEDGFLVVMLSKS**********************************************************************VAGNDLEQTIQQIMDMGGGTWDKETVTRALQAAYNNPERAVDYLYSISSL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLADNKVSEDGFLVVMLSKSKTLGSAGASSAQPAHTTPPTTAPSSNSTPPQEASVPPPAPTPSIPASNVTSNVTAANANSDTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRALQAAYNNPERAVDYLYSISSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query197 2.2.26 [Sep-21-2011]
Q84L33 371 Putative DNA repair prote yes no 0.954 0.506 0.689 1e-71
Q84L32 368 Putative DNA repair prote no no 0.944 0.505 0.699 3e-67
Q84L31 419 Putative DNA repair prote no no 0.979 0.460 0.480 1e-50
Q84L30 378 Putative DNA repair prote no no 0.923 0.481 0.542 1e-49
Q40742 392 Probable DNA repair prote no no 0.954 0.479 0.517 1e-46
P54725 363 UV excision repair protei yes no 0.934 0.506 0.369 1e-26
P54728 416 UV excision repair protei yes no 0.954 0.451 0.342 1e-26
P54727 409 UV excision repair protei no no 0.954 0.459 0.324 2e-26
A3KMV2 362 UV excision repair protei yes no 0.944 0.513 0.368 4e-26
Q4KMA2 415 UV excision repair protei yes no 0.954 0.453 0.333 1e-25
>sp|Q84L33|RD23A_ARATH Putative DNA repair protein RAD23-1 OS=Arabidopsis thaliana GN=RAD23-1 PE=2 SV=3 Back     alignment and function desciption
 Score =  268 bits (686), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 133/193 (68%), Positives = 158/193 (81%), Gaps = 5/193 (2%)

Query: 1   MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA 60
           MKLTVKTLKGSHFEIRV PSDT+MAVKKNIED QGKDNYPCGQQLLIHNGKVLKDET+L 
Sbjct: 1   MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV 60

Query: 61  DNKVSEDGFLVVMLSKSKTLGSAGASSAQPAHTTPPTTAPSSNSTPPQEASVPPPAPTPS 120
           +NKV+E+GFLVVMLSKSK+ GSAG +S Q +  + P +A +S++ P    + P    +  
Sbjct: 61  ENKVTEEGFLVVMLSKSKSGGSAGQASVQTSSVSQPVSATTSSTKP----AAPSTTQSSP 116

Query: 121 IPASNVTSNVTAANANSDTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRALQAA 180
           +PAS + +    A A +DTYGQAAS LV+G+ LEQ +QQIM+MGGG+WDKETVTRAL+AA
Sbjct: 117 VPASPIPAQEQPA-AQTDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRALRAA 175

Query: 181 YNNPERAVDYLYS 193
           YNNPERAVDYLYS
Sbjct: 176 YNNPERAVDYLYS 188




May be involved in nucleotide excision repair.
Arabidopsis thaliana (taxid: 3702)
>sp|Q84L32|RD23B_ARATH Putative DNA repair protein RAD23-2 OS=Arabidopsis thaliana GN=RAD23-2 PE=2 SV=2 Back     alignment and function description
>sp|Q84L31|RD23C_ARATH Putative DNA repair protein RAD23-3 OS=Arabidopsis thaliana GN=RAD23-3 PE=2 SV=2 Back     alignment and function description
>sp|Q84L30|RD23D_ARATH Putative DNA repair protein RAD23-4 OS=Arabidopsis thaliana GN=RAD23-4 PE=2 SV=2 Back     alignment and function description
>sp|Q40742|RAD23_ORYSJ Probable DNA repair protein RAD23 OS=Oryza sativa subsp. japonica GN=RAD23 PE=1 SV=2 Back     alignment and function description
>sp|P54725|RD23A_HUMAN UV excision repair protein RAD23 homolog A OS=Homo sapiens GN=RAD23A PE=1 SV=1 Back     alignment and function description
>sp|P54728|RD23B_MOUSE UV excision repair protein RAD23 homolog B OS=Mus musculus GN=Rad23b PE=1 SV=2 Back     alignment and function description
>sp|P54727|RD23B_HUMAN UV excision repair protein RAD23 homolog B OS=Homo sapiens GN=RAD23B PE=1 SV=1 Back     alignment and function description
>sp|A3KMV2|RD23A_BOVIN UV excision repair protein RAD23 homolog A OS=Bos taurus GN=RAD23A PE=2 SV=1 Back     alignment and function description
>sp|Q4KMA2|RD23B_RAT UV excision repair protein RAD23 homolog B OS=Rattus norvegicus GN=Rad23b PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
358249346 363 uncharacterized protein LOC100819019 [Gl 0.954 0.517 0.766 2e-78
255641364 363 unknown [Glycine max] 0.954 0.517 0.766 2e-78
356521680 343 PREDICTED: putative DNA repair protein R 0.954 0.548 0.761 2e-77
356521678 363 PREDICTED: putative DNA repair protein R 0.954 0.517 0.761 2e-77
356521682 348 PREDICTED: putative DNA repair protein R 0.878 0.497 0.751 9e-75
356550683 353 PREDICTED: putative DNA repair protein R 0.862 0.481 0.735 2e-73
449501601 401 PREDICTED: putative DNA repair protein R 0.974 0.478 0.679 2e-73
358346471 366 RAD23 protein [Medicago truncatula] gi|3 0.928 0.5 0.721 1e-72
356550681 367 PREDICTED: putative DNA repair protein R 0.913 0.490 0.746 5e-72
449439755 358 PREDICTED: putative DNA repair protein R 0.868 0.477 0.725 9e-72
>gi|358249346|ref|NP_001240038.1| uncharacterized protein LOC100819019 [Glycine max] gi|255647960|gb|ACU24437.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 148/193 (76%), Positives = 165/193 (85%), Gaps = 5/193 (2%)

Query: 1   MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA 60
           MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTL 
Sbjct: 1   MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV 60

Query: 61  DNKVSEDGFLVVMLSKSKTLGSAGASSAQPAHTTPPTTAPSSNSTPPQEASVPPPAPTPS 120
           +NKVSEDGFLVVMLSKSKT GSA ASS QPA + PPTT  +SNSTPP +    PP  T +
Sbjct: 61  ENKVSEDGFLVVMLSKSKTSGSAAASSVQPA-SNPPTTVSTSNSTPPSD----PPVQTQA 115

Query: 121 IPASNVTSNVTAANANSDTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRALQAA 180
              S  +++    N ++DTYG AASNLVAG++LEQTIQQIMDMGGG WD++TV+RAL+AA
Sbjct: 116 ANNSTSSTDAPTTNVSADTYGLAASNLVAGSNLEQTIQQIMDMGGGNWDRDTVSRALRAA 175

Query: 181 YNNPERAVDYLYS 193
           YNNPERA+DYLYS
Sbjct: 176 YNNPERAIDYLYS 188




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255641364|gb|ACU20959.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356521680|ref|XP_003529481.1| PREDICTED: putative DNA repair protein RAD23-1-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356521678|ref|XP_003529480.1| PREDICTED: putative DNA repair protein RAD23-1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356521682|ref|XP_003529482.1| PREDICTED: putative DNA repair protein RAD23-1-like isoform 3 [Glycine max] Back     alignment and taxonomy information
>gi|356550683|ref|XP_003543714.1| PREDICTED: putative DNA repair protein RAD23-1-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|449501601|ref|XP_004161413.1| PREDICTED: putative DNA repair protein RAD23-1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|358346471|ref|XP_003637291.1| RAD23 protein [Medicago truncatula] gi|355503226|gb|AES84429.1| RAD23 protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356550681|ref|XP_003543713.1| PREDICTED: putative DNA repair protein RAD23-1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|449439755|ref|XP_004137651.1| PREDICTED: putative DNA repair protein RAD23-1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
TAIR|locus:2200522 368 RAD23A "RADIATION SENSITIVE23A 0.944 0.505 0.616 1.6e-56
TAIR|locus:2076944 419 RAD23C "RADIATION SENSITIVE23C 0.421 0.198 0.626 2.3e-47
TAIR|locus:2177376 378 RAD23D "RADIATION SENSITIVE23D 0.954 0.497 0.471 2.6e-40
RGD|1562958 415 Rad23b "RAD23 homolog B (S. ce 0.421 0.2 0.445 9.5e-24
UNIPROTKB|A3KMV2 362 RAD23A "UV excision repair pro 0.390 0.212 0.415 2e-23
UNIPROTKB|F1PTL1 362 RAD23A "Uncharacterized protei 0.390 0.212 0.415 2e-23
MGI|MGI:105128 416 Rad23b "RAD23b homolog (S. cer 0.421 0.199 0.433 2.1e-23
UNIPROTKB|K7ESE3 308 RAD23A "UV excision repair pro 0.385 0.246 0.407 2.6e-23
UNIPROTKB|F1SP32 408 RAD23B "Uncharacterized protei 0.406 0.196 0.437 3.2e-23
UNIPROTKB|P54727 409 RAD23B "UV excision repair pro 0.416 0.200 0.426 3.2e-23
TAIR|locus:2200522 RAD23A "RADIATION SENSITIVE23A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 582 (209.9 bits), Expect = 1.6e-56, P = 1.6e-56
 Identities = 119/193 (61%), Positives = 131/193 (67%)

Query:     1 MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA 60
             MKLTVKTLKGSHFEIRV P+DT+MAVKKNIED Q KDNYPCGQQLLIHNGKVLKDETTL 
Sbjct:     1 MKLTVKTLKGSHFEIRVLPTDTIMAVKKNIEDSQSKDNYPCGQQLLIHNGKVLKDETTLV 60

Query:    61 DNKVSEDGFLVVMLSKSKTLGSAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
             +NKV+E+GFLVVMLSKSKT  SAG                                    
Sbjct:    61 ENKVTEEGFLVVMLSKSKTASSAGPSSTQPTSTTTSTISSTTLAAPSTTQSIAVPASNST 120

Query:   121 XXXXXXXXXXXXXXXXXDTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRALQAA 180
                              DTYGQAAS LV+G+ +EQ +QQIM+MGGG+WDKETVTRAL+AA
Sbjct:   121 PVQEQPTAQS-------DTYGQAASTLVSGSSIEQMVQQIMEMGGGSWDKETVTRALRAA 173

Query:   181 YNNPERAVDYLYS 193
             YNNPERAVDYLYS
Sbjct:   174 YNNPERAVDYLYS 186




GO:0003684 "damaged DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA;IDA
GO:0006284 "base-excision repair" evidence=ISS
GO:0006289 "nucleotide-excision repair" evidence=IEA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0043130 "ubiquitin binding" evidence=IDA
GO:0070628 "proteasome binding" evidence=IDA
TAIR|locus:2076944 RAD23C "RADIATION SENSITIVE23C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177376 RAD23D "RADIATION SENSITIVE23D" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1562958 Rad23b "RAD23 homolog B (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A3KMV2 RAD23A "UV excision repair protein RAD23 homolog A" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PTL1 RAD23A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:105128 Rad23b "RAD23b homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|K7ESE3 RAD23A "UV excision repair protein RAD23 homolog A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SP32 RAD23B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P54727 RAD23B "UV excision repair protein RAD23 homolog B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
TIGR00601 378 TIGR00601, rad23, UV excision repair protein Rad23 5e-60
cd0180577 cd01805, RAD23_N, Ubiquitin-like domain of RAD23 3e-34
smart0021372 smart00213, UBQ, Ubiquitin homologues 9e-23
cd0176969 cd01769, UBL, Ubiquitin-like domain of UBL 1e-18
pfam0024069 pfam00240, ubiquitin, Ubiquitin family 2e-15
cd01802103 cd01802, AN1_N, ubiquitin-like domain of AN1 8e-11
pfam0062737 pfam00627, UBA, UBA/TS-N domain 2e-10
cd0180972 cd01809, Scythe_N, Ubiquitin-like domain of Scythe 2e-10
cd0180376 cd01803, Ubiquitin, Ubiquitin 9e-10
cd0019669 cd00196, UBQ, Ubiquitin-like proteins 1e-09
cd0180676 cd01806, Nedd8, Nebb8-like ubiquitin protein 3e-09
cd0019438 cd00194, UBA, Ubiquitin Associated domain 3e-08
PTZ0004476 PTZ00044, PTZ00044, ubiquitin; Provisional 1e-06
smart0016537 smart00165, UBA, Ubiquitin associated domain 1e-06
pfam1197672 pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO- 3e-06
cd0180774 cd01807, GDX_N, ubiquitin-like domain of GDX 2e-04
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.002
PRK11901 327 PRK11901, PRK11901, hypothetical protein; Reviewed 0.002
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 0.003
>gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 Back     alignment and domain information
 Score =  191 bits (487), Expect = 5e-60
 Identities = 83/200 (41%), Positives = 119/200 (59%), Gaps = 14/200 (7%)

Query: 1   MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA 60
           M LT KTL+   F+I ++P +TV  +K+ IE  QGKD YP  QQ LI++GK+L D+ T+ 
Sbjct: 1   MTLTFKTLQQQKFKIDMEPDETVKELKEKIEAEQGKDAYPVAQQKLIYSGKILSDDKTVK 60

Query: 61  DNKVSEDGFLVVMLSKSKTL-GSAGASSAQPAHTTPPTTAPSSNSTPPQEASVPPPAPTP 119
           + K+ E  F+VVM+SK KT  G     +A P  T+ PT  PS  ++P    S  P +   
Sbjct: 61  EYKIKEKDFVVVMVSKPKTGTGKVAPPAATP--TSAPTPTPSPPASPASGMSAAPASAVE 118

Query: 120 SIPASNVTSNVTA-ANANSDTYG-----QAASNLVAGNDLEQTIQQIMDMGGGTWDKETV 173
               S    + TA A  +  T        AAS LV G++ E TI++IM+MG   +++E V
Sbjct: 119 --EKSPSEESATATAPESPSTSVPSSGSDAASTLVVGSERETTIEEIMEMG---YEREEV 173

Query: 174 TRALQAAYNNPERAVDYLYS 193
            RAL+AA+NNP+RAV+YL +
Sbjct: 174 ERALRAAFNNPDRAVEYLLT 193


All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair]. Length = 378

>gnl|CDD|176400 cd01805, RAD23_N, Ubiquitin-like domain of RAD23 Back     alignment and domain information
>gnl|CDD|214563 smart00213, UBQ, Ubiquitin homologues Back     alignment and domain information
>gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL Back     alignment and domain information
>gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family Back     alignment and domain information
>gnl|CDD|176397 cd01802, AN1_N, ubiquitin-like domain of AN1 Back     alignment and domain information
>gnl|CDD|201355 pfam00627, UBA, UBA/TS-N domain Back     alignment and domain information
>gnl|CDD|176404 cd01809, Scythe_N, Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>gnl|CDD|176398 cd01803, Ubiquitin, Ubiquitin Back     alignment and domain information
>gnl|CDD|176352 cd00196, UBQ, Ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|176401 cd01806, Nedd8, Nebb8-like ubiquitin protein Back     alignment and domain information
>gnl|CDD|238116 cd00194, UBA, Ubiquitin Associated domain Back     alignment and domain information
>gnl|CDD|185411 PTZ00044, PTZ00044, ubiquitin; Provisional Back     alignment and domain information
>gnl|CDD|197551 smart00165, UBA, Ubiquitin associated domain Back     alignment and domain information
>gnl|CDD|192903 pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO-like Back     alignment and domain information
>gnl|CDD|176402 cd01807, GDX_N, ubiquitin-like domain of GDX Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237015 PRK11901, PRK11901, hypothetical protein; Reviewed Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 197
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 100.0
KOG0011 340 consensus Nucleotide excision repair factor NEF2, 100.0
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 99.84
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 99.82
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 99.81
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 99.8
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 99.8
PTZ0004476 ubiquitin; Provisional 99.79
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 99.78
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 99.78
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 99.77
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 99.77
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 99.77
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 99.77
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 99.77
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 99.76
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 99.76
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 99.76
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 99.75
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 99.74
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 99.72
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 99.71
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 99.68
KOG000570 consensus Ubiquitin-like protein [Cell cycle contr 99.67
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 99.66
KOG0010 493 consensus Ubiquitin-like protein [Posttranslationa 99.6
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 99.58
KOG0003128 consensus Ubiquitin/60s ribosomal protein L40 fusi 99.58
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 99.58
KOG0004156 consensus Ubiquitin/40S ribosomal protein S27a fus 99.55
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 99.54
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 99.49
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 99.46
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 99.44
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 99.38
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 99.36
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 99.27
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 99.22
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 99.19
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 99.15
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 99.12
KOG4248 1143 consensus Ubiquitin-like protein, regulator of apo 99.09
KOG000175 consensus Ubiquitin and ubiquitin-like proteins [P 99.04
PLN02560 308 enoyl-CoA reductase 99.03
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 98.96
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 98.92
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 98.92
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 98.73
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 98.66
cd0181180 OASL_repeat1 2'-5' oligoadenylate synthetase-like 98.46
KOG0006 446 consensus E3 ubiquitin-protein ligase (Parkin prot 98.45
KOG1872 473 consensus Ubiquitin-specific protease [Posttransla 98.38
KOG349373 consensus Ubiquitin-like protein [Posttranslationa 98.36
KOG0944763 consensus Ubiquitin-specific protease UBP14 [Postt 98.29
KOG176999 consensus Ubiquitin-like proteins [Posttranslation 98.11
KOG4495110 consensus RNA polymerase II transcription elongati 98.02
PF1030297 DUF2407: DUF2407 ubiquitin-like domain; InterPro: 97.96
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 97.83
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 97.72
KOG4583 391 consensus Membrane-associated ER protein involved 97.71
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 97.67
smart0016680 UBX Domain present in ubiquitin-regulatory protein 97.56
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 97.51
KOG0418200 consensus Ubiquitin-protein ligase [Posttranslatio 97.5
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 97.45
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 97.45
COG541781 Uncharacterized small protein [Function unknown] 97.41
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 97.4
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 97.34
KOG0013231 consensus Uncharacterized conserved protein [Funct 97.28
COG5227103 SMT3 Ubiquitin-like protein (sentrin) [Posttransla 97.28
smart0054643 CUE Domain that may be involved in binding ubiquit 97.17
cd0177382 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i 97.01
KOG1639297 consensus Steroid reductase required for elongatio 96.92
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 96.86
KOG0011340 consensus Nucleotide excision repair factor NEF2, 96.79
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 96.72
PF13019162 Telomere_Sde2: Telomere stability and silencing 96.58
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 96.57
COG5207749 UBP14 Isopeptidase T [Posttranslational modificati 96.27
PF0928855 UBA_3: Fungal ubiquitin-associated domain ; InterP 96.21
KOG0010493 consensus Ubiquitin-like protein [Posttranslationa 96.19
KOG3206234 consensus Alpha-tubulin folding cofactor B [Posttr 96.19
KOG2561 568 consensus Adaptor protein NUB1, contains UBA domai 96.12
PF1504476 CLU_N: Mitochondrial function, CLU-N-term 95.74
PF0697260 DUF1296: Protein of unknown function (DUF1296); In 95.68
COG5207 749 UBP14 Isopeptidase T [Posttranslational modificati 95.58
KOG0944 763 consensus Ubiquitin-specific protease UBP14 [Postt 95.56
PF1445357 ThiS-like: ThiS-like ubiquitin 95.53
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 95.45
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 95.33
PF0749947 RuvA_C: RuvA, C-terminal domain; InterPro: IPR0111 95.09
PRK0643767 hypothetical protein; Provisional 95.03
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 94.95
KOG0012 380 consensus DNA damage inducible protein [Replicatio 94.65
PLN0279982 Molybdopterin synthase sulfur carrier subunit 94.4
PRK0836470 sulfur carrier protein ThiS; Provisional 93.77
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 93.51
cd0075480 MoaD Ubiquitin domain of MoaD-like proteins. MoaD 93.5
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 93.47
PF1483688 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A 93.12
PRK0648865 sulfur carrier protein ThiS; Validated 93.07
PF1162088 GABP-alpha: GA-binding protein alpha chain; InterP 92.11
PRK06369115 nac nascent polypeptide-associated complex protein 92.04
PF0893879 HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This 91.52
TIGR00264116 alpha-NAC-related protein. This hypothetical prote 91.41
KOG2086380 consensus Protein tyrosine phosphatase SHP1/Cofact 91.29
PF12754309 Blt1: Cell-cycle control medial ring component; In 91.07
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 90.92
PF1079076 DUF2604: Protein of Unknown function (DUF2604); In 90.81
TIGR0168280 moaD molybdopterin converting factor, subunit 1, n 90.72
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 90.66
PF0259777 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiam 90.29
TIGR0168788 moaD_arch MoaD family protein, archaeal. Members o 89.87
smart00295207 B41 Band 4.1 homologues. Also known as ezrin/radix 89.33
PRK0586365 sulfur carrier protein ThiS; Provisional 88.78
cd0176072 RBD Ubiquitin-like domain of RBD-like S/T kinases. 88.19
cd0640886 PB1_NoxR The PB1 domain is present in the Epichloe 88.14
smart0045570 RBD Raf-like Ras-binding domain. 87.54
PRK0565966 sulfur carrier protein ThiS; Validated 87.54
COG5100 571 NPL4 Nuclear pore protein [Nuclear structure] 87.29
PRK0805366 sulfur carrier protein ThiS; Provisional 87.02
PF10209122 DUF2340: Uncharacterized conserved protein (DUF234 86.18
cd0599281 PB1 The PB1 domain is a modular domain mediating s 85.85
PF0056484 PB1: PB1 domain; InterPro: IPR000270 The Phox and 85.74
PF07223358 DUF1421: Protein of unknown function (DUF1421); In 85.62
PF0858746 UBA_2: Ubiquitin associated domain (UBA) ; InterPr 85.47
PRK0694465 sulfur carrier protein ThiS; Provisional 85.42
cd0056565 ThiS ThiaminS ubiquitin-like sulfur carrier protei 85.1
TIGR00084191 ruvA Holliday junction DNA helicase, RuvA subunit. 85.06
PF1106998 DUF2870: Protein of unknown function (DUF2870); In 85.05
PF1154753 E3_UbLigase_EDD: E3 ubiquitin ligase EDD; InterPro 84.53
TIGR02958 452 sec_mycoba_snm4 secretion protein snm4. Members of 84.24
PRK0608384 sulfur carrier protein ThiS; Provisional 83.66
PF1261675 DUF3775: Protein of unknown function (DUF3775); In 83.0
PF0295442 HTH_8: Bacterial regulatory protein, Fis family; I 82.77
COG210468 ThiS Sulfur transfer protein involved in thiamine 82.34
cd0178785 GRB7_RA RA (RAS-associated like) domain of Grb7. G 81.03
PF0219671 RBD: Raf-like Ras-binding domain; InterPro: IPR003 80.97
PRK13901196 ruvA Holliday junction DNA helicase RuvA; Provisio 80.79
PF1473287 UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquiti 80.53
PRK0769667 sulfur carrier protein ThiS; Provisional 80.38
TIGR0168364 thiS thiamine biosynthesis protein ThiS. This mode 80.27
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
Probab=100.00  E-value=1.4e-44  Score=317.91  Aligned_cols=190  Identities=41%  Similarity=0.644  Sum_probs=130.7

Q ss_pred             CEEEEEeCCCcEEEEEeCCCCCHHHHHHHHHHHhCCCCCCCCCeEEEeCCeecCCCCcccccccCCCCeEEEEecccCCC
Q 029207            1 MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLADNKVSEDGFLVVMLSKSKTL   80 (197)
Q Consensus         1 M~I~Vk~~~g~~~~iev~~~~TV~~LK~~I~~~~g~~~~p~~~qrLi~~Gk~L~D~~tL~~~~I~~~~~I~l~~~~~~~~   80 (197)
                      |+|+||+++|++|.|+|++++||.+||++|+...|.+.+++++|||||+||+|+|+++|++|+|+++++|+||+++++..
T Consensus         1 MkItVKtl~g~~~~IeV~~~~TV~dLK~kI~~~~g~~~ip~~~QkLIy~GkiL~Dd~tL~dy~I~e~~~Ivvmv~k~k~~   80 (378)
T TIGR00601         1 MTLTFKTLQQQKFKIDMEPDETVKELKEKIEAEQGKDAYPVAQQKLIYSGKILSDDKTVREYKIKEKDFVVVMVSKPKTG   80 (378)
T ss_pred             CEEEEEeCCCCEEEEEeCCcChHHHHHHHHHHhhCCCCCChhHeEEEECCEECCCCCcHHHcCCCCCCEEEEEeccCCCC
Confidence            89999999999999999999999999999999987433899999999999999999999999999999999999988764


Q ss_pred             CCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCC--C--CCCCC-CCCCccccccCCCCCCccccccccccCCCchH
Q 029207           81 GSAGASSAQPA-HTTPPTTAPSSNSTPPQEASVPPPA--P--TPSIP-ASNVTSNVTAANANSDTYGQAASNLVAGNDLE  154 (197)
Q Consensus        81 ~~~~~~~~~~~-~~~~p~~~~~~~~~p~~~p~~~~~~--~--~p~~~-~~~~~~~~~~~~~~~~~~~~~~s~l~~g~~~~  154 (197)
                      ....+.++..+ +++.+.. ..+. +|...+...+..  .  ++.+. +.+ +...+++.........+.+.|++|+++|
T Consensus        81 ~~~~~~~~~~~~~~p~~~~-~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~s~l~~g~~~e  157 (378)
T TIGR00601        81 TGKSAPPAATPTSAPTPTP-SPPA-SPASGMSAAPASAVEEKSPSEESATA-TAPESPSTSVPSSGSDAASTLVVGSERE  157 (378)
T ss_pred             CCCCCCCCCCCCCCCCCCC-CCCC-CCCCCCCCCCCCCCccccccCCCCCC-CCCCCCCccccccCCCcccccccchHHH
Confidence            32221111011 1111000 0000 011000000000  0  00000 000 0000000000010125678999999999


Q ss_pred             HHHHHHHHcCCCCCCHHHHHHHHHHhcCCHHHHHHHhhC--cCC
Q 029207          155 QTIQQIMDMGGGTWDKETVTRALQAAYNNPERAVDYLYS--ISS  196 (197)
Q Consensus       155 ~~i~~l~~MG~~~~~~~~~~~aL~~~~~N~~~A~EyL~~--~~~  196 (197)
                      ++|++||+||   |+|++|++|||||||||||||||||+  |+.
T Consensus       158 ~~I~~i~eMG---f~R~qV~~ALRAafNNPdRAVEYL~tGIP~~  198 (378)
T TIGR00601       158 TTIEEIMEMG---YEREEVERALRAAFNNPDRAVEYLLTGIPED  198 (378)
T ss_pred             HHHHHHHHhC---CCHHHHHHHHHHHhCCHHHHHHHHHhCCCcc
Confidence            9999999999   99999999999999999999999999  754



All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).

>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0001 consensus Ubiquitin and ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1872 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3493 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4495 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B [Transcription] Back     alignment and domain information
>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>KOG4583 consensus Membrane-associated ER protein involved in stress response (contains ubiquitin-like domain) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>COG5417 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>KOG0013 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain Back     alignment and domain information
>KOG1639 consensus Steroid reductase required for elongation of the very long chain fatty acids [Lipid transport and metabolism] Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>PF13019 Telomere_Sde2: Telomere stability and silencing Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>KOG3206 consensus Alpha-tubulin folding cofactor B [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF15044 CLU_N: Mitochondrial function, CLU-N-term Back     alignment and domain information
>PF06972 DUF1296: Protein of unknown function (DUF1296); InterPro: IPR009719 This family represents a conserved region approximately 60 residues long within a number of plant proteins of unknown function Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14453 ThiS-like: ThiS-like ubiquitin Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>PF07499 RuvA_C: RuvA, C-terminal domain; InterPro: IPR011114 In prokaryotes, RuvA, RuvB, and RuvC process the universal DNA intermediate of homologous recombination, termed Holliday junction Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>KOG0012 consensus DNA damage inducible protein [Replication, recombination and repair] Back     alignment and domain information
>PLN02799 Molybdopterin synthase sulfur carrier subunit Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A Back     alignment and domain information
>PRK06488 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>PF11620 GABP-alpha: GA-binding protein alpha chain; InterPro: IPR024668 GA-binding protein alpha is a transcription factor capable of interacting with purine rich repeats (GA repeats) Back     alignment and domain information
>PRK06369 nac nascent polypeptide-associated complex protein; Reviewed Back     alignment and domain information
>PF08938 HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This domain is found in various eukaryotic HBS1-like proteins Back     alignment and domain information
>TIGR00264 alpha-NAC-related protein Back     alignment and domain information
>KOG2086 consensus Protein tyrosine phosphatase SHP1/Cofactor for p97 ATPase-mediated vesicle membrane fusion [Nuclear structure] Back     alignment and domain information
>PF12754 Blt1: Cell-cycle control medial ring component; InterPro: IPR024737 During size-dependent cell cycle transitions controlled by the ubiquitous cyclin-dependent kinase Cdk1, Blt1 has been shown to co-localise with Cdr2 in the medial interphase nodes, as well as with Mid1 which was previously shown to localise to similar interphase structures Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>PF10790 DUF2604: Protein of Unknown function (DUF2604); InterPro: IPR019726 This entry represents bacterial proteins with undetermined function Back     alignment and domain information
>TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>PF02597 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer Back     alignment and domain information
>TIGR01687 moaD_arch MoaD family protein, archaeal Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>PRK05863 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases Back     alignment and domain information
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA Back     alignment and domain information
>smart00455 RBD Raf-like Ras-binding domain Back     alignment and domain information
>PRK05659 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>COG5100 NPL4 Nuclear pore protein [Nuclear structure] Back     alignment and domain information
>PRK08053 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PF10209 DUF2340: Uncharacterized conserved protein (DUF2340); InterPro: IPR018794 This entry consists of small proteins of approximately 150 amino acids whose function is unknown Back     alignment and domain information
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information
>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins Back     alignment and domain information
>PF07223 DUF1421: Protein of unknown function (DUF1421); InterPro: IPR010820 This family represents a conserved region approximately 350 residues long within a number of plant proteins of unknown function Back     alignment and domain information
>PF08587 UBA_2: Ubiquitin associated domain (UBA) ; InterPro: IPR013896 This is a UBA (ubiquitin associated) protein [] Back     alignment and domain information
>PRK06944 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein Back     alignment and domain information
>TIGR00084 ruvA Holliday junction DNA helicase, RuvA subunit Back     alignment and domain information
>PF11069 DUF2870: Protein of unknown function (DUF2870); InterPro: IPR021298 This is a eukaryotic family of proteins with unknown function Back     alignment and domain information
>PF11547 E3_UbLigase_EDD: E3 ubiquitin ligase EDD; InterPro: IPR024725 EDD, the ER ubiquitin ligase from the HECT ligases, contains an N-terminal ubiquitin-associated (UBA) domain which binds ubiquitin Back     alignment and domain information
>TIGR02958 sec_mycoba_snm4 secretion protein snm4 Back     alignment and domain information
>PRK06083 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PF12616 DUF3775: Protein of unknown function (DUF3775); InterPro: IPR022254 This domain family is found in bacteria, and is approximately 80 amino acids in length Back     alignment and domain information
>PF02954 HTH_8: Bacterial regulatory protein, Fis family; InterPro: IPR002197 The Factor for Inversion Stimulation (FIS) protein is a regulator of bacterial functions, and binds specifically to weakly related DNA sequences [,] Back     alignment and domain information
>COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>cd01787 GRB7_RA RA (RAS-associated like) domain of Grb7 Back     alignment and domain information
>PF02196 RBD: Raf-like Ras-binding domain; InterPro: IPR003116 This is the Ras-binding domain found in proteins related to Ras Back     alignment and domain information
>PRK13901 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PF14732 UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquitin-like domain; PDB: 1Y8Q_B 1Y8R_E 3KYD_B 3KYC_B Back     alignment and domain information
>PRK07696 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>TIGR01683 thiS thiamine biosynthesis protein ThiS Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
1uel_A95 Solution Structure Of Ubiquitin-Like Domain Of Hhr2 1e-14
1p1a_A85 Nmr Structure Of Ubiquitin-Like Domain Of Hhr23b Le 2e-14
1oqy_A 368 Structure Of The Dna Repair Protein Hhr23a Length = 2e-13
1oqy_A 368 Structure Of The Dna Repair Protein Hhr23a Length = 9e-08
2wyq_A85 The Crystal Structure Of The Ubiquitin-Like (Ubl) D 3e-13
1p98_A78 High-Resolution Nmr Structure Of The Ubl-Domain Of 2e-12
3v6c_B91 Crystal Structure Of Usp2 In Complex With Mutated U 5e-08
3v6e_B91 Crystal Structure Of Usp2 And A Mutant Form Of Ubiq 8e-08
3dbh_I88 Structural Dissection Of A Gating Mechanism Prevent 1e-07
3dbl_I88 Structural Dissection Of A Gating Mechanism Prevent 1e-07
2nvu_I81 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 1e-07
4hcp_B78 Crystal Structure Of Burkholderia Pseudomallei Effe 1e-07
4f8c_B88 Structure Of The Cif:nedd8 Complex - Yersinia Pseud 1e-07
2bkr_B77 Nedd8 Nedp1 Complex Length = 77 2e-07
1ndd_B76 Structure Of Nedd8 Length = 76 2e-07
3gzn_I82 Structure Of Nedd8-Activating Enzyme In Complex Wit 2e-07
3dqv_A81 Structural Insights Into Nedd8 Activation Of Cullin 3e-07
3jvz_X81 E2~ubiquitin-Hect Length = 81 3e-07
1yx5_B98 Solution Structure Of S5a Uim-1UBIQUITIN COMPLEX Le 3e-07
2ojr_A111 Structure Of Ubiquitin Solved By Sad Using The Lant 4e-07
3vdz_A111 Tailoring Encodable Lanthanide-Binding Tags As Mri 4e-07
4ap4_C80 Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le 4e-07
3k9o_B96 The Crystal Structure Of E2-25k And Ubb+1 Complex L 4e-07
2ld9_A77 Backbone Structure Of Ubiquitin Determined Using Ba 4e-07
2zvn_A154 Nemo Cozi Domain Incomplex With Diubiquitin In P212 4e-07
2khw_B79 Solution Structure Of The Human Polymerase Iota Ubm 4e-07
3dvg_Y79 Crystal Structure Of K63-Specific Fab Apu.3a8 Bound 4e-07
3u30_A172 Crystal Structure Of A Linear-Specific Ubiquitin Fa 4e-07
2w9n_A152 Crystal Structure Of Linear Di-Ubiquitin Length = 1 4e-07
3dvg_X80 Crystal Structure Of K63-Specific Fab Apu.3a8 Bound 4e-07
3b08_A152 Crystal Structure Of The Mouse Hoil1-L-Nzf In Compl 5e-07
2xk5_B76 Crystal Structure Of K6-Linked Diubiquitin Length = 5e-07
2znv_B76 Crystal Structure Of Human Amsh-Lp Dub Domain In Co 5e-07
1aar_A76 Structure Of A Diubiquitin Conjugate And A Model Fo 5e-07
3nob_A78 Structure Of K11-Linked Di-Ubiquitin Length = 78 5e-07
1sif_A88 Crystal Structure Of A Multiple Hydrophobic Core Mu 5e-07
2znv_C77 Crystal Structure Of Human Amsh-Lp Dub Domain In Co 5e-07
4i6l_B76 Crystal Structure Of Otub1 In Complex With Ubiquiti 5e-07
1xd3_B75 Crystal Structure Of Uchl3-Ubvme Complex Length = 7 5e-07
1cmx_B76 Structural Basis For The Specificity Of Ubiquitin C 5e-07
3rul_A79 New Strategy To Analyze Structures Of Glycopeptide- 5e-07
2y5b_B152 Structure Of Usp21 In Complex With Linear Diubiquit 5e-07
3ldz_F73 Crystal Structure Of Human Stam1 Vhs Domain In Comp 6e-07
3ons_A72 Crystal Structure Of Human Ubiquitin In A New Cryst 6e-07
2gbr_A81 Crystal Structure Of The 35-36 Moad Insertion Mutan 6e-07
3ai5_A307 Crystal Structure Of Yeast Enhanced Green Fluoresce 6e-07
2k6d_B76 Cin85 Sh3-C Domain In Complex With Ubiquitin Length 7e-07
1zgu_B76 Solution Structure Of The Human Mms2-Ubiquitin Comp 7e-07
2o6v_D76 Crystal Structure And Solution Nmr Studies Of Lys48 7e-07
2fcs_A76 X-Ray Crystal Structure Of A Chemically Synthesized 1e-06
3q3f_A189 Engineering Domain-Swapped Binding Interfaces By Mu 1e-06
2k25_A103 Automated Nmr Structure Of The Ubb By Fapsy Length 1e-06
1yiw_A76 X-Ray Crystal Structure Of A Chemically Synthesized 1e-06
1yj1_A76 X-Ray Crystal Structure Of A Chemically Synthesized 1e-06
3mtn_B85 Usp21 In Complex With A Ubiquitin-based, Usp21-spec 2e-06
2o6v_B76 Crystal Structure And Solution Nmr Studies Of Lys48 2e-06
1c3t_A76 Rotamer Strain As A Determinant Of Protein Structur 2e-06
1s1q_B76 Tsg101(Uev) Domain In Complex With Ubiquitin Length 2e-06
3n3k_B85 The Catalytic Domain Of Usp8 In Complex With A Usp8 2e-06
3h7s_A76 Crystal Structures Of K63-Linked Di- And Tri-Ubiqui 2e-06
2zcb_A76 Crystal Structure Of Ubiquitin P37aP38A Length = 76 3e-06
1bt0_A76 Structure Of Ubiquitin-Like Protein, Rub1 Length = 3e-06
4hjk_A77 U7ub7 Disulfide Variant Length = 77 4e-06
1ud7_A76 Solution Structure Of The Designed Hydrophobic Core 4e-06
1ify_A49 Solution Structure Of The Internal Uba Domain Of Hh 6e-06
1ogw_A76 Synthetic Ubiquitin With Fluoro-Leu At 50 And 67 Le 7e-06
3olm_D79 Structure And Function Of A Ubiquitin Binding Site 7e-06
4hcn_B98 Crystal Structure Of Burkholderia Pseudomallei Effe 7e-06
1otr_B76 Solution Structure Of A Cue-Ubiquitin Complex Lengt 8e-06
4ii3_B96 Crystal Structure Of S. Pombe Ubiquitin Activating 9e-06
4gsw_A80 Crystal Structure Of Ubiquitin From Entamoeba Histo 9e-06
3l0w_B169 Structure Of Split Monoubiquitinated Pcna With Ubiq 9e-06
3u5g_f152 The Structure Of The Eukaryotic Ribosome At 3.0 A R 1e-05
4ii2_B83 Crystal Structure Of Ubiquitin Activating Enzyme 1 1e-05
3zf7_s128 High-resolution Cryo-electron Microscopy Structure 1e-05
2jwz_A76 Mutations In The Hydrophobic Core Of Ubiquitin Diff 2e-05
3u5e_m128 The Structure Of The Eukaryotic Ribosome At 3.0 A R 2e-05
4hk2_A78 U7ub25.2540 Length = 78 2e-05
4a18_K129 T.Thermophila 60s Ribosomal Subunit In Complex With 2e-05
2gbm_A84 Crystal Structure Of The 35-36 8 Glycine Insertion 2e-05
2jvc_A82 Nmr Solution Structure Of Ubiquitin Like Protein Le 2e-05
3u5c_f152 The Structure Of The Eukaryotic Ribosome At 3.0 A R 3e-05
2gbk_A83 Crystal Structure Of The 9-10 Moad Insertion Mutant 6e-05
2kdi_A114 Solution Structure Of A UbiquitinUIM FUSION PROTEIN 6e-05
1zw7_A82 Elimination Of The C-Cap In Ubiquitin Structure, Dy 6e-05
1gjz_A53 Solution Structure Of A Dimeric N-Terminal Fragment 2e-04
2gbj_A84 Crystal Structure Of The 9-10 8 Glycine Insertion M 4e-04
>pdb|1UEL|A Chain A, Solution Structure Of Ubiquitin-Like Domain Of Hhr23b Complexed With Ubiquitin-Interacting Motif Of Proteasome Subunit S5a Length = 95 Back     alignment and structure

Iteration: 1

Score = 76.3 bits (186), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 35/84 (41%), Positives = 56/84 (66%) Query: 1 MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA 60 M++T+KTL+ F+I + P +TV A+K+ IE +GKD +P Q LI+ GK+L D+T L Sbjct: 1 MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALK 60 Query: 61 DNKVSEDGFLVVMLSKSKTLGSAG 84 + K+ E F+VVM++K K + + Sbjct: 61 EYKIDEKNFVVVMVTKPKAVSTPA 84
>pdb|1P1A|A Chain A, Nmr Structure Of Ubiquitin-Like Domain Of Hhr23b Length = 85 Back     alignment and structure
>pdb|1OQY|A Chain A, Structure Of The Dna Repair Protein Hhr23a Length = 368 Back     alignment and structure
>pdb|1OQY|A Chain A, Structure Of The Dna Repair Protein Hhr23a Length = 368 Back     alignment and structure
>pdb|2WYQ|A Chain A, The Crystal Structure Of The Ubiquitin-Like (Ubl) Domain Of Hhr23a (Human Homologue A Of Rad23) Length = 85 Back     alignment and structure
>pdb|1P98|A Chain A, High-Resolution Nmr Structure Of The Ubl-Domain Of Hhr23a Length = 78 Back     alignment and structure
>pdb|3V6C|B Chain B, Crystal Structure Of Usp2 In Complex With Mutated Ubiquitin Length = 91 Back     alignment and structure
>pdb|3V6E|B Chain B, Crystal Structure Of Usp2 And A Mutant Form Of Ubiquitin Length = 91 Back     alignment and structure
>pdb|3DBH|I Chain I, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190ala-Nedd8ala72arg) Length = 88 Back     alignment and structure
>pdb|3DBL|I Chain I, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190wt-Nedd8ala72gln) Length = 88 Back     alignment and structure
>pdb|2NVU|I Chain I, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 81 Back     alignment and structure
>pdb|4HCP|B Chain B, Crystal Structure Of Burkholderia Pseudomallei Effector Protein Chbp In Complex With Nedd8 Length = 78 Back     alignment and structure
>pdb|4F8C|B Chain B, Structure Of The Cif:nedd8 Complex - Yersinia Pseudotuberculosis Cycle Inhibiting Factor In Complex With Human Nedd8 Length = 88 Back     alignment and structure
>pdb|2BKR|B Chain B, Nedd8 Nedp1 Complex Length = 77 Back     alignment and structure
>pdb|1NDD|B Chain B, Structure Of Nedd8 Length = 76 Back     alignment and structure
>pdb|3GZN|I Chain I, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 82 Back     alignment and structure
>pdb|3DQV|A Chain A, Structural Insights Into Nedd8 Activation Of Cullin-Ring Ligases: Conformational Control Of Conjugation Length = 81 Back     alignment and structure
>pdb|3JVZ|X Chain X, E2~ubiquitin-Hect Length = 81 Back     alignment and structure
>pdb|1YX5|B Chain B, Solution Structure Of S5a Uim-1UBIQUITIN COMPLEX Length = 98 Back     alignment and structure
>pdb|2OJR|A Chain A, Structure Of Ubiquitin Solved By Sad Using The Lanthanide- Binding Tag Length = 111 Back     alignment and structure
>pdb|3VDZ|A Chain A, Tailoring Encodable Lanthanide-Binding Tags As Mri Contrast Agents: Xq-Dse3-Ubiquitin At 2.4 Angstroms Length = 111 Back     alignment and structure
>pdb|4AP4|C Chain C, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 80 Back     alignment and structure
>pdb|3K9O|B Chain B, The Crystal Structure Of E2-25k And Ubb+1 Complex Length = 96 Back     alignment and structure
>pdb|2LD9|A Chain A, Backbone Structure Of Ubiquitin Determined Using Backbone Amide Noes And Backbone N-H And N-C Rdcs Length = 77 Back     alignment and structure
>pdb|2ZVN|A Chain A, Nemo Cozi Domain Incomplex With Diubiquitin In P212121 Space Group Length = 154 Back     alignment and structure
>pdb|2KHW|B Chain B, Solution Structure Of The Human Polymerase Iota Ubm2- Ubiquitin Complex Length = 79 Back     alignment and structure
>pdb|3DVG|Y Chain Y, Crystal Structure Of K63-Specific Fab Apu.3a8 Bound To K63-Linked Di- Ubiquitin Length = 79 Back     alignment and structure
>pdb|3U30|A Chain A, Crystal Structure Of A Linear-Specific Ubiquitin Fab Bound To Linear Ubiquitin Length = 172 Back     alignment and structure
>pdb|2W9N|A Chain A, Crystal Structure Of Linear Di-Ubiquitin Length = 152 Back     alignment and structure
>pdb|3DVG|X Chain X, Crystal Structure Of K63-Specific Fab Apu.3a8 Bound To K63-Linked Di- Ubiquitin Length = 80 Back     alignment and structure
>pdb|3B08|A Chain A, Crystal Structure Of The Mouse Hoil1-L-Nzf In Complex With Linear Di- Ubiquitin Length = 152 Back     alignment and structure
>pdb|2XK5|B Chain B, Crystal Structure Of K6-Linked Diubiquitin Length = 76 Back     alignment and structure
>pdb|2ZNV|B Chain B, Crystal Structure Of Human Amsh-Lp Dub Domain In Complex With Lys63-Linked Ubiquitin Dimer Length = 76 Back     alignment and structure
>pdb|1AAR|A Chain A, Structure Of A Diubiquitin Conjugate And A Model For Interaction With Ubiquitin Conjugating Enzyme (E2) Length = 76 Back     alignment and structure
>pdb|3NOB|A Chain A, Structure Of K11-Linked Di-Ubiquitin Length = 78 Back     alignment and structure
>pdb|1SIF|A Chain A, Crystal Structure Of A Multiple Hydrophobic Core Mutant Of Ubiquitin Length = 88 Back     alignment and structure
>pdb|2ZNV|C Chain C, Crystal Structure Of Human Amsh-Lp Dub Domain In Complex With Lys63-Linked Ubiquitin Dimer Length = 77 Back     alignment and structure
>pdb|4I6L|B Chain B, Crystal Structure Of Otub1 In Complex With Ubiquitin Variant Length = 76 Back     alignment and structure
>pdb|1XD3|B Chain B, Crystal Structure Of Uchl3-Ubvme Complex Length = 75 Back     alignment and structure
>pdb|1CMX|B Chain B, Structural Basis For The Specificity Of Ubiquitin C- Terminal Hydrolases Length = 76 Back     alignment and structure
>pdb|3RUL|A Chain A, New Strategy To Analyze Structures Of Glycopeptide-Target Complexes Length = 79 Back     alignment and structure
>pdb|2Y5B|B Chain B, Structure Of Usp21 In Complex With Linear Diubiquitin-Aldehyde Length = 152 Back     alignment and structure
>pdb|3LDZ|F Chain F, Crystal Structure Of Human Stam1 Vhs Domain In Complex With Ubiquitin Length = 73 Back     alignment and structure
>pdb|3ONS|A Chain A, Crystal Structure Of Human Ubiquitin In A New Crystal Form Length = 72 Back     alignment and structure
>pdb|2GBR|A Chain A, Crystal Structure Of The 35-36 Moad Insertion Mutant Of Ubiquitin Length = 81 Back     alignment and structure
>pdb|3AI5|A Chain A, Crystal Structure Of Yeast Enhanced Green Fluorescent Protein- Ubiquitin Fusion Protein Length = 307 Back     alignment and structure
>pdb|2K6D|B Chain B, Cin85 Sh3-C Domain In Complex With Ubiquitin Length = 76 Back     alignment and structure
>pdb|1ZGU|B Chain B, Solution Structure Of The Human Mms2-Ubiquitin Complex Length = 76 Back     alignment and structure
>pdb|2O6V|D Chain D, Crystal Structure And Solution Nmr Studies Of Lys48-Linked Tetraubiquitin At Neutral Ph Length = 76 Back     alignment and structure
>pdb|2FCS|A Chain A, X-Ray Crystal Structure Of A Chemically Synthesized [l-Gln35]ubiquitin With A Cubic Space Group Length = 76 Back     alignment and structure
>pdb|3Q3F|A Chain A, Engineering Domain-Swapped Binding Interfaces By Mutually Exclusive Folding: Insertion Of Ubiquitin Into Position 103 Of Barnase Length = 189 Back     alignment and structure
>pdb|2K25|A Chain A, Automated Nmr Structure Of The Ubb By Fapsy Length = 103 Back     alignment and structure
>pdb|1YIW|A Chain A, X-Ray Crystal Structure Of A Chemically Synthesized Ubiquitin Length = 76 Back     alignment and structure
>pdb|1YJ1|A Chain A, X-Ray Crystal Structure Of A Chemically Synthesized [d-Gln35]ubiquitin Length = 76 Back     alignment and structure
>pdb|3MTN|B Chain B, Usp21 In Complex With A Ubiquitin-based, Usp21-specific Inhibitor Length = 85 Back     alignment and structure
>pdb|2O6V|B Chain B, Crystal Structure And Solution Nmr Studies Of Lys48-Linked Tetraubiquitin At Neutral Ph Length = 76 Back     alignment and structure
>pdb|1C3T|A Chain A, Rotamer Strain As A Determinant Of Protein Structural Specificity Length = 76 Back     alignment and structure
>pdb|1S1Q|B Chain B, Tsg101(Uev) Domain In Complex With Ubiquitin Length = 76 Back     alignment and structure
>pdb|3N3K|B Chain B, The Catalytic Domain Of Usp8 In Complex With A Usp8 Specific Inhibitor Length = 85 Back     alignment and structure
>pdb|3H7S|A Chain A, Crystal Structures Of K63-Linked Di- And Tri-Ubiquitin Reveal A Highly Extended Chain Architecture Length = 76 Back     alignment and structure
>pdb|2ZCB|A Chain A, Crystal Structure Of Ubiquitin P37aP38A Length = 76 Back     alignment and structure
>pdb|1BT0|A Chain A, Structure Of Ubiquitin-Like Protein, Rub1 Length = 76 Back     alignment and structure
>pdb|4HJK|A Chain A, U7ub7 Disulfide Variant Length = 77 Back     alignment and structure
>pdb|1UD7|A Chain A, Solution Structure Of The Designed Hydrophobic Core Mutant Of Ubiquitin, 1d7 Length = 76 Back     alignment and structure
>pdb|1IFY|A Chain A, Solution Structure Of The Internal Uba Domain Of Hhr23a Length = 49 Back     alignment and structure
>pdb|1OGW|A Chain A, Synthetic Ubiquitin With Fluoro-Leu At 50 And 67 Length = 76 Back     alignment and structure
>pdb|3OLM|D Chain D, Structure And Function Of A Ubiquitin Binding Site Within The Catalytic Domain Of A Hect Ubiquitin Ligase Length = 79 Back     alignment and structure
>pdb|4HCN|B Chain B, Crystal Structure Of Burkholderia Pseudomallei Effector Protein Chbp In Complex With Ubiquitin Length = 98 Back     alignment and structure
>pdb|1OTR|B Chain B, Solution Structure Of A Cue-Ubiquitin Complex Length = 76 Back     alignment and structure
>pdb|4II3|B Chain B, Crystal Structure Of S. Pombe Ubiquitin Activating Enzyme 1 (uba1) In Complex With Ubiquitin And Atp/mg Length = 96 Back     alignment and structure
>pdb|4GSW|A Chain A, Crystal Structure Of Ubiquitin From Entamoeba Histolytica To 2.15 Angstrom Length = 80 Back     alignment and structure
>pdb|3L0W|B Chain B, Structure Of Split Monoubiquitinated Pcna With Ubiquitin In Position Two Length = 169 Back     alignment and structure
>pdb|3U5G|FF Chain f, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 40s Subunit, Ribosome B Length = 152 Back     alignment and structure
>pdb|4II2|B Chain B, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 83 Back     alignment and structure
>pdb|3ZF7|SS Chain s, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 128 Back     alignment and structure
>pdb|2JWZ|A Chain A, Mutations In The Hydrophobic Core Of Ubiquitin Differentially Affect Its Recognition By Receptor Proteins Length = 76 Back     alignment and structure
>pdb|3U5E|MM Chain m, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 60s Subunit, Ribosome A Length = 128 Back     alignment and structure
>pdb|4HK2|A Chain A, U7ub25.2540 Length = 78 Back     alignment and structure
>pdb|4A18|K Chain K, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 26s Rrna And Proteins Of Molecule 1 Length = 129 Back     alignment and structure
>pdb|2GBM|A Chain A, Crystal Structure Of The 35-36 8 Glycine Insertion Mutant Of Ubiquitin Length = 84 Back     alignment and structure
>pdb|2JVC|A Chain A, Nmr Solution Structure Of Ubiquitin Like Protein Length = 82 Back     alignment and structure
>pdb|3U5C|FF Chain f, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 40s Subunit, Ribosome A Length = 152 Back     alignment and structure
>pdb|2GBK|A Chain A, Crystal Structure Of The 9-10 Moad Insertion Mutant Of Ubiquitin Length = 83 Back     alignment and structure
>pdb|2KDI|A Chain A, Solution Structure Of A UbiquitinUIM FUSION PROTEIN Length = 114 Back     alignment and structure
>pdb|1ZW7|A Chain A, Elimination Of The C-Cap In Ubiquitin Structure, Dynamics And Thermodynamic Consequences Length = 82 Back     alignment and structure
>pdb|1GJZ|A Chain A, Solution Structure Of A Dimeric N-Terminal Fragment Of Human Ubiquitin Length = 53 Back     alignment and structure
>pdb|2GBJ|A Chain A, Crystal Structure Of The 9-10 8 Glycine Insertion Mutant Of Ubiquitin. Length = 84 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 4e-45
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 6e-38
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 7e-38
3m62_B106 UV excision repair protein RAD23; armadillo-like r 1e-33
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 4e-31
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 8e-25
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 7e-24
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 2e-23
3u5c_F225 RP14, S2, YS8, 40S ribosomal protein S5; translati 4e-22
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 5e-22
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 2e-21
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 3e-21
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 3e-21
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 7e-21
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 2e-20
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 3e-20
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 4e-20
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 8e-20
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 1e-19
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 2e-19
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 2e-19
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 2e-19
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 2e-19
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 3e-19
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 7e-19
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 1e-18
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 1e-18
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 3e-18
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 1e-17
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 4e-17
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 6e-17
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 2e-16
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 3e-16
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 4e-16
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 2e-15
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 3e-15
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 6e-15
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 7e-15
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 2e-09
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 1e-14
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 2e-14
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 8e-14
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 1e-13
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 1e-08
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 2e-13
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 2e-13
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 2e-10
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 5e-13
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 7e-12
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 1e-10
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 3e-10
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 1e-09
1we6_A111 Splicing factor, putative; structural genomics, ub 3e-09
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 7e-09
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 1e-08
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 2e-08
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 2e-08
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 1e-07
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 4e-07
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 8e-07
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 2e-06
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 1e-05
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 1e-05
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 2e-05
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 1e-04
2fnj_B118 Transcription elongation factor B polypeptide 2; b 2e-04
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 2e-04
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 2e-04
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 2e-04
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 3e-04
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 2e-04
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 9e-04
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 Back     alignment and structure
 Score =  152 bits (383), Expect = 4e-45
 Identities = 63/201 (31%), Positives = 105/201 (52%), Gaps = 11/201 (5%)

Query: 1   MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA 60
           + +T+KTL+   F+IR++P +TV  +K+ IE  +G+D +P   Q LI+ GK+L D+  + 
Sbjct: 8   VTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIR 67

Query: 61  DNKVSEDGFLVVMLSKSKTLGSAGASSAQPAHTTPPTTAPSSNSTPPQEASVPPPAPTPS 120
           D ++ E  F+VVM++K+K      A         P ++     +     +  PP A    
Sbjct: 68  DYRIDEKNFVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAAREDK 127

Query: 121 IPASNVTSNVTAANAN--------SDTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKET 172
            P+       +  + +        S     AAS LV G++ E  + +IM MG   +++E 
Sbjct: 128 SPSEESAPTTSPESVSGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMG---YERER 184

Query: 173 VTRALQAAYNNPERAVDYLYS 193
           V  AL+A+YNNP RAV+YL +
Sbjct: 185 VVAALRASYNNPHRAVEYLLT 205


>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Length = 85 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Length = 84 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Length = 76 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Length = 88 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 94 Back     alignment and structure
>3u5c_F RP14, S2, YS8, 40S ribosomal protein S5; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_F 3o30_D 3o2z_D 3u5g_F 3jyv_G* 2noq_F 1s1h_G 3iz6_F Length = 225 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Length = 90 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} Length = 85 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 85 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Length = 76 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Length = 88 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: k.45.1.1 PDB: 3dbr_I 3dbl_I Length = 88 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Length = 98 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Length = 128 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Length = 96 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Length = 76 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Length = 111 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Length = 88 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 87 Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 49 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Length = 114 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Length = 189 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 125 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Length = 79 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 78 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Length = 152 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Length = 152 Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Length = 169 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 89 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Length = 115 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Length = 172 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Length = 172 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Length = 159 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Length = 159 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 93 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Length = 189 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102 Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 111 Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Length = 307 Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Length = 105 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 73 Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Length = 93 Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Length = 100 Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Length = 116 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Length = 90 Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Length = 118 Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 105 Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118 Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Length = 107 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Length = 126 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 100.0
3m62_B106 UV excision repair protein RAD23; armadillo-like r 99.86
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 99.84
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 99.84
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 99.84
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 99.84
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 99.83
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 99.82
3v6c_B91 Ubiquitin; structural genomics, structural genomic 99.82
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 99.82
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 99.82
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 99.81
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 99.81
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 99.81
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 99.81
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 99.81
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 99.8
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 99.8
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 99.8
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 99.8
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 99.8
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 99.8
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 99.8
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 99.8
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 99.79
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 99.79
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 99.79
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 99.79
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 99.79
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 99.79
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 99.78
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 99.78
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 99.78
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 99.78
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 99.78
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 99.78
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 99.78
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 99.77
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 99.77
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 99.77
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 99.77
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 99.77
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 99.76
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 99.76
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 99.76
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 99.62
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 99.75
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.75
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 99.75
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 99.74
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 99.74
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 99.73
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 99.73
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 99.73
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 99.73
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.73
2fnj_B118 Transcription elongation factor B polypeptide 2; b 99.73
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 99.73
4ajy_B118 Transcription elongation factor B polypeptide 2; E 99.72
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 99.72
1we6_A111 Splicing factor, putative; structural genomics, ub 99.72
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 99.72
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 99.71
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.71
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 99.71
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 99.7
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.7
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 99.7
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 99.69
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 99.69
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 99.68
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.68
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.67
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 99.67
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.67
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 99.66
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 99.65
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 99.61
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 99.61
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 99.59
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 99.58
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 99.57
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 99.54
2kj6_A97 Tubulin folding cofactor B; methods development, N 99.54
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 99.53
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 99.51
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 99.5
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 99.5
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 99.48
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 99.48
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 99.47
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 99.46
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 99.46
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 99.45
3shq_A 320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 99.45
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 99.45
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 99.44
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 99.44
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 99.43
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 99.42
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 99.41
1wji_A63 Tudor domain containing protein 3; UBA domain, str 99.4
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 99.4
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 99.4
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 99.39
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 99.38
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 99.38
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 99.38
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 99.35
2dna_A67 Unnamed protein product; ubiquitin associated doma 99.35
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 99.33
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 99.32
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 99.32
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 99.31
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 99.31
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 99.3
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 99.3
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 99.23
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 99.23
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 99.22
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 99.21
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 99.15
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 99.1
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 99.1
2cwb_A108 Chimera of immunoglobulin G binding protein G and 99.09
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 99.09
2oo9_A46 E3 ubiquitin-protein ligase CBL; alpha-helical dom 99.03
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 98.99
2juj_A56 E3 ubiquitin-protein ligase CBL; alpha helix, UBA 98.98
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 98.88
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 98.82
2pjh_A80 Protein NPL4, nuclear protein localization protein 98.8
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 98.75
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 98.73
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 98.68
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 98.65
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 98.59
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 98.56
3v7o_A227 Minor nucleoprotein VP30; ssgcid, seattle structur 98.56
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 98.54
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 98.46
2cos_A54 Serine/threonine protein kinase LATS2; UBA domain, 98.45
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 98.41
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 98.4
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 98.34
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 98.29
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 98.2
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 98.18
3ix6_A 360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 98.09
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 98.07
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 98.07
4da1_A 389 Protein phosphatase 1K, mitochondrial; metal-ION-a 97.88
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 97.8
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 97.69
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 97.46
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 97.45
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 97.36
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 97.31
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 97.17
2dhy_A67 CUE domain-containing protein 1; structural genomi 97.14
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 97.02
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 96.95
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 96.94
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 96.09
1q02_A52 Sequestosome 1; helical bundle, protein binding; N 96.06
2di0_A71 Activating signal cointegrator 1 complex subunit 2 96.0
2daj_A91 KIAA0977 protein, COBL-like 1; ubiquitin-like doma 95.94
3ihp_A 854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 95.76
4e71_A111 Plexin-B2, MM1; transmembrane, signaling, RBD, str 95.71
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 95.7
1ryj_A70 Unknown; beta/alpha protein, structural genomics, 95.69
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 95.51
2r2o_A138 Plexin-B1; effector domain, structural genomics, s 95.44
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 94.93
1p3q_Q54 VPS9P, vacuolar protein sorting-associated protein 94.8
3h6n_A127 Plexin-D1; structural genomics consortium, SGC, me 94.69
1vjk_A98 Molybdopterin converting factor, subunit 1; struct 94.67
3rpf_C74 Molybdopterin converting factor, subunit 1 (MOAD); 94.54
4dbg_B162 Ring finger protein 31; ubiquitin fold, ubiquitina 94.42
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 94.05
4e74_A117 Plexin-A4; RBD, structural genomics, structural ge 93.59
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 93.58
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 93.4
2juo_A89 GA-binding protein alpha chain; OST, ubiquitin, tr 93.4
1tr8_A102 Conserved protein (MTH177); chaperones, nascent po 93.37
2dal_A62 Protein KIAA0794; FAS associted factor 1, UBA-like 93.29
3po0_A89 Small archaeal modifier protein 1; ubiquitin-like 92.49
1ufz_A83 Hypothetical protein BAB28515; HBS1-like domain, s 92.26
1ixs_A62 Holliday junction DNA helicase RUVA; heterodimeric 91.75
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 91.14
1tyg_B87 YJBS; alpha beta barrel, protein-protein complex, 90.95
4dbg_B162 Ring finger protein 31; ubiquitin fold, ubiquitina 90.65
3dwg_C93 9.5 kDa culture filtrate antigen CFP10A; sulfur ca 90.64
3kuz_A126 Plexin-C1; structural genomics, structural genomic 90.54
2dzl_A66 Protein FAM100B; UBA-like domain, structural genom 90.28
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 89.99
2kmm_A73 Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohy 89.93
1wgk_A114 Riken cDNA 2900073H19 protein; THis domain, ubiqut 89.12
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 88.77
1vd2_A89 Protein kinase C, IOTA type; PB1 domain, OPCA moti 88.61
3onh_A127 Ubiquitin-activating enzyme E1-like; ligase, SUMO 88.14
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 88.13
3hm6_X 644 Plexin-B1; structural genomics consortium, SGC, me 87.99
1f0z_A66 THis protein; ubiquitin fold, transport protein; N 87.98
1vdl_A80 Ubiquitin carboxyl-terminal hydrolase 25; UBA doma 87.9
2k5p_A78 THis protein, thiamine-biosynthesis protein; NESG, 87.59
3e21_A45 HFAF1, FAS-associated factor 1; UBA, alternative s 87.54
2dam_A67 ETEA protein; KIAA0887, UBA-like domain, structura 87.46
1wgr_A100 Growth factor receptor-bound protein 7; RA domain, 87.15
3ig3_A 627 Plxna3 protein; plexin intracellular GAP RBD inact 86.69
2kl0_A73 Putative thiamin biosynthesis THis; structural gen 86.5
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 86.47
2l52_A99 Methanosarcina acetivorans SAMP1 homolog; beta-grA 86.19
1ip9_A85 BEM1 protein; ubiquitin alpha/beta roll, signaling 86.06
2qho_B53 E3 ubiquitin-protein ligase EDD1; protein-protein 86.04
2k9x_A110 Tburm1, uncharacterized protein; unknown function; 85.6
2kvr_A130 Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi 85.52
2qjl_A99 URM1, ubiquitin-related modifier 1; ubiquitin-like 84.74
2q5w_D77 Molybdopterin converting factor, subunit 1; MOCO, 84.56
2cu3_A64 Unknown function protein; thermus thermophilus HB8 83.77
3e7l_A63 Transcriptional regulator (NTRC family); sigma43 a 81.06
2ns5_A85 Partitioning-defective 3 homolog; cell polarity, N 80.82
1y8x_B98 Ubiquitin-activating enzyme E1C; ubiquitin-conjuga 80.16
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
Probab=100.00  E-value=1.9e-38  Score=277.78  Aligned_cols=187  Identities=32%  Similarity=0.568  Sum_probs=126.0

Q ss_pred             CEEEEEeCCCcEEEEEeCCCCCHHHHHHHHHHH---hCCCCCCCCCeEEEeCCeecCCCCcccccccCCCCeEEEEeccc
Q 029207            1 MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDV---QGKDNYPCGQQLLIHNGKVLKDETTLADNKVSEDGFLVVMLSKS   77 (197)
Q Consensus         1 M~I~Vk~~~g~~~~iev~~~~TV~~LK~~I~~~---~g~~~~p~~~qrLi~~Gk~L~D~~tL~~~~I~~~~~I~l~~~~~   77 (197)
                      |+|+||+++|++|.|+|++++||.+||++|+..   .|   +++++|||||+||+|+|+++|++|+|+++++|++|+.+.
T Consensus         8 M~I~VKtl~Gk~~~leV~~~~TV~~LK~~I~~~~~~~g---ip~~~QrLiy~GK~L~D~~tL~dygI~~gstIv~lv~k~   84 (368)
T 1oqy_A            8 VTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDA---FPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTKT   84 (368)
T ss_dssp             CCEEEEETTTEEEEECCCTTCBHHHHHHHHHHHTCSSS---CCSTEEEEESSSSEECSSSBTTTTCCCTTSCEEEEEECC
T ss_pred             EEEEEEeCCCCEEEEEeCCCChHHHHHHHHHHHhCcCC---CChhheEEEECCeecCCcCCHHHcCCCCCCEEEEEEecC
Confidence            899999999999999999999999999999994   56   999999999999999999999999999999996666665


Q ss_pred             CCCCC-CCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCcc---ccccCCCCCCccccccccccC
Q 029207           78 KTLGS-AGASSAQPAHTTP--PTTAPSSNSTPPQEASVP--PPAPTPSIPASNVTS---NVTAANANSDTYGQAASNLVA  149 (197)
Q Consensus        78 ~~~~~-~~~~~~~~~~~~~--p~~~~~~~~~p~~~p~~~--~~~~~p~~~~~~~~~---~~~~~~~~~~~~~~~~s~l~~  149 (197)
                      +..+. +.+..+.+.+.+.  +..+..+...+...+...  +....++++++..+.   ...+.......++.+.|.|++
T Consensus        85 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~s~l~~  164 (368)
T 1oqy_A           85 KAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAAREDKSPSEESAPTTSPESVSGSVPSSGSSGREEDAASTLVT  164 (368)
T ss_dssp             CSSSCCCCCSSCCCCCSSSCCCSCCCSSSCCCCCCCSSSSCCCCCSCSCCCCSSTTCSCCCSCSCCCSCCCCCCCTTTCC
T ss_pred             CCCCCCCCCcccCCCCCccccCCCCCCCCCCCCCCCccccccCCccccCCCCCCCCcccccccccccccccccccccccC
Confidence            54332 2111111111100  000000000000000000  000000011100000   001111112334567899999


Q ss_pred             CCchHHHHHHHHHcCCCCCCHHHHHHHHHHhcCCHHHHHHHhhC
Q 029207          150 GNDLEQTIQQIMDMGGGTWDKETVTRALQAAYNNPERAVDYLYS  193 (197)
Q Consensus       150 g~~~~~~i~~l~~MG~~~~~~~~~~~aL~~~~~N~~~A~EyL~~  193 (197)
                      |+++++.|++|++||   |+|++|++|||++|||+|||||||++
T Consensus       165 g~~~~~~i~~l~~MG---f~~~~~~~AL~a~~nn~~~A~e~L~~  205 (368)
T 1oqy_A          165 GSEYETMLTEIMSMG---YERERVVAALRASYNNPHRAVEYLLT  205 (368)
T ss_dssp             TTTHHHHHHHHHTTT---CCSHHHHHHHHHSCSSTTHHHHTTTT
T ss_pred             CcchHHHHHHHHHcC---CCHHHHHHHHHHcCCCHHHHHHHHHh
Confidence            999999999999999   99999999999999999999999998



>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A Back     alignment and structure
>2di0_A Activating signal cointegrator 1 complex subunit 2; ASCC2, CUE domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>4e71_A Plexin-B2, MM1; transmembrane, signaling, RBD, structural genomics consortium, SGC, signaling protein; 2.26A {Homo sapiens} Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>1p3q_Q VPS9P, vacuolar protein sorting-associated protein VPS9; trafficking, post translational modification, mono- ubiquitination; 1.70A {Saccharomyces cerevisiae} SCOP: a.5.2.4 PDB: 1mn3_A Back     alignment and structure
>3h6n_A Plexin-D1; structural genomics consortium, SGC, membrane, transmembrane, receptor, alternative splicing, cell membrane, glycoprotein, polymorphism; 2.00A {Homo sapiens} Back     alignment and structure
>1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 Back     alignment and structure
>3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} Back     alignment and structure
>4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Back     alignment and structure
>4e74_A Plexin-A4; RBD, structural genomics, structural genomics consor SGC, signaling protein; 1.58A {Homo sapiens} PDB: 3q3j_A* Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>2juo_A GA-binding protein alpha chain; OST, ubiquitin, transcription factor, ensemble, DNA-binding, nucleus, transcription regulation; NMR {Mus musculus} Back     alignment and structure
>1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis} Back     alignment and structure
>2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A Back     alignment and structure
>1ufz_A Hypothetical protein BAB28515; HBS1-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, translatio; NMR {Mus musculus} SCOP: a.5.9.1 Back     alignment and structure
>1ixs_A Holliday junction DNA helicase RUVA; heterodimeric protein complex, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.20A {Thermus thermophilus} SCOP: a.5.1.1 Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Back     alignment and structure
>1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 Back     alignment and structure
>4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} Back     alignment and structure
>3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A Back     alignment and structure
>3kuz_A Plexin-C1; structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Back     alignment and structure
>2kmm_A Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohydrolase; methods development, TGS domain, predominantly beta-sheet structure; NMR {Porphyromonas gingivalis} Back     alignment and structure
>1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A Back     alignment and structure
>3onh_A Ubiquitin-activating enzyme E1-like; ligase, SUMO conjugation, UBC9; 1.60A {Saccharomyces cerevisiae} PDB: 3ong_A Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>3hm6_X Plexin-B1; structural genomics consortium, SGC, membrane, transmembrane receptor, cell membrane, glycoprotein, phosphoprotein; 2.40A {Homo sapiens} PDB: 3sua_D* 3su8_X* Back     alignment and structure
>1f0z_A THis protein; ubiquitin fold, transport protein; NMR {Escherichia coli} SCOP: d.15.3.2 PDB: 1zud_2 Back     alignment and structure
>1vdl_A Ubiquitin carboxyl-terminal hydrolase 25; UBA domain, mouse cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2k5p_A THis protein, thiamine-biosynthesis protein; NESG, GMR137, structural genomics, PSI-2, protein structure initiative; NMR {Geobacter metallireducens gs-15} PDB: 3cwi_A Back     alignment and structure
>3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} Back     alignment and structure
>2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wgr_A Growth factor receptor-bound protein 7; RA domain, GRB7, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>3ig3_A Plxna3 protein; plexin intracellular GAP RBD inactive, membrane, transmembra membrane protein, signaling protein; 1.99A {Mus musculus} PDB: 3ryt_A* Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Back     alignment and structure
>2l52_A Methanosarcina acetivorans SAMP1 homolog; beta-grAsp fold, protein binding, E1-like, SAMP activator, ELSA, adenylation, ubiquitin; NMR {Methanosarcina acetivorans} Back     alignment and structure
>1ip9_A BEM1 protein; ubiquitin alpha/beta roll, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 1ipg_A 2kfk_A Back     alignment and structure
>2qho_B E3 ubiquitin-protein ligase EDD1; protein-protein complex, protein binding/ligase complex; 1.85A {Homo sapiens} Back     alignment and structure
>2k9x_A Tburm1, uncharacterized protein; unknown function; NMR {Trypanosoma brucei} Back     alignment and structure
>2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} Back     alignment and structure
>2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A Back     alignment and structure
>2q5w_D Molybdopterin converting factor, subunit 1; MOCO, MPT synthase, MOAD, MOAE, transferase, molybdenum cofactor biosynthesis; 2.00A {Staphylococcus aureus} PDB: 2qie_B* Back     alignment and structure
>2cu3_A Unknown function protein; thermus thermophilus HB8, structural genomics, riken structu genomics/proteomics initiative, RSGI, NPPSFA; 1.70A {Thermus thermophilus} SCOP: d.15.3.2 PDB: 2htm_E Back     alignment and structure
>3e7l_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; 2.25A {Aquifex aeolicus} PDB: 4fth_A Back     alignment and structure
>2ns5_A Partitioning-defective 3 homolog; cell polarity, N-terminal domain, PB1 domain, asymmetric membrane localization, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>1y8x_B Ubiquitin-activating enzyme E1C; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: c.111.1.2 PDB: 3fn1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 197
d1oqya477 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 h 1e-26
d1uela_95 d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homol 3e-24
d1bt0a_73 d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis t 2e-19
d1ogwa_76 d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [Tax 1e-18
d1wiaa_95 d.15.1.1 (A:) Ubiquitin-like protein bab25500 (201 2e-18
d1wgda_93 d.15.1.1 (A:) Homocysteine-responsive endoplasmic 3e-17
d1z2ma276 d.15.1.1 (A:79-154) Interferon-induced 15 kDa prot 3e-17
d1wx9a173 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 9e-17
d1wgha_116 d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mous 1e-16
d1z2ma176 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protei 3e-16
d1oqya141 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Hum 5e-16
d2zeqa178 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin 1e-15
d2bwfa173 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc 2e-15
d1ttna180 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquit 3e-15
d1wy8a176 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING fing 1e-14
d1wh3a_87 d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like 1e-14
d2faza176 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING fing 1e-13
d1zkha186 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t 4e-13
d1v5ta_90 d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus mu 7e-13
d1wjua_100 d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human 2e-12
d1v5oa_102 d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus mu 7e-12
d1uh6a_100 d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mous 8e-12
d1wgga_96 d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolas 9e-12
d2c9wb1103 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) 1e-11
d1se9a_101 d.15.1.1 (A:) Hypothetical protein At3g01050 {Thal 4e-11
d1v2ya_105 d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik 5e-11
d1wx8a183 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus muscul 1e-10
d1m94a_73 d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 2e-10
d1j8ca_103 d.15.1.1 (A:) Ubiquitin-like N-terminal domain of 2e-09
d2uyzb177 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human 3e-09
d1wxva181 d.15.1.1 (A:7-87) Bag-family molecular chaperone r 5e-09
d1wgna_63 a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 6e-09
d1yqba184 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapien 7e-09
d1wiva_73 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 7e-09
d1wjia_63 a.5.2.1 (A:) Tudor domain containing protein 3, TD 6e-08
d1euvb_79 d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yea 7e-08
d1v86a_95 d.15.1.1 (A:) hypothetical D7wsu128e protein {Mous 2e-07
d1x1ma194 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse 4e-07
d1vg5a_73 a.5.2.1 (A:) Rhomboid family protein At3g58460 {Th 5e-07
d1v6ea_95 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 8e-07
d1wjna_97 d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse 3e-06
d1t0ya_90 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 2e-05
d1whca_64 a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus 0.002
d2cpwa151 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 0.003
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Ubiquitin-like domain of Rad23 homolog A (Hhr23a)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 94.9 bits (236), Expect = 1e-26
 Identities = 29/75 (38%), Positives = 51/75 (68%)

Query: 1  MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA 60
          + +T+KTL+   F+IR++P +TV  +K+ IE  +G+D +P   Q LI+ GK+L D+  + 
Sbjct: 3  VTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIR 62

Query: 61 DNKVSEDGFLVVMLS 75
          D ++ E  F+VVM++
Sbjct: 63 DYRIDEKNFVVVMVT 77


>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 101 Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 105 Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 83 Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Length = 79 Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 90 Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 64 Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 99.89
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 99.88
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 99.87
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 99.86
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 99.86
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 99.85
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 99.85
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 99.85
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 99.85
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 99.84
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 99.83
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 99.83
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 99.82
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.82
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 99.82
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 99.81
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 99.8
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 99.79
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 99.78
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.78
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 99.77
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 99.77
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 99.76
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 99.76
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 99.75
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 99.75
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 99.71
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 99.71
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 99.71
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 99.71
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 99.58
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 99.54
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 99.53
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 99.5
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 99.47
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 99.45
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 99.45
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 99.44
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 99.44
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 99.29
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 99.29
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 99.28
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 99.11
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 99.07
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 99.06
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.9
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 98.89
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 98.89
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 98.84
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus 98.78
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 98.7
d1z96a138 UBA-domain protein mud1 {Schizosaccharomyces pombe 98.37
d3e46a142 Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal 98.27
d1oqya244 DNA repair protein Hhr23a {Human (Homo sapiens) [T 98.21
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 97.86
d2cosa141 Serine/threonine protein kinase LATS2 {Mouse (Mus 97.77
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 97.63
d1vega_83 NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu 97.55
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 97.37
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 97.31
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 97.24
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 97.2
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 97.13
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 97.09
d1wgla_59 Toll-interacting protein {Human (Homo sapiens) [Ta 96.97
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 96.97
d1mn3a_54 Vacuolar protein sorting-associated protein vps9 { 96.49
d2dkla172 Trinucleotide repeat containing 6c protein, TNRC6C 96.32
d1ttea155 Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc 96.16
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 96.14
d2cp8a141 Migration-inducing protein 19 NBR1 {Human (Homo sa 95.81
d1v92a_46 NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { 94.61
d2k0bx152 Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [Tax 92.27
d1ef1a384 Moesin {Human (Homo sapiens) [TaxId: 9606]} 92.2
d1xo3a_101 C9orf74 homolog {Mouse (Mus musculus) [TaxId: 1009 91.89
d1cuka148 DNA helicase RuvA subunit, C-terminal domain {Esch 90.77
d1gg3a381 Erythroid membrane protein 4.1R {Human (Homo sapie 90.73
d2di0a163 Activating signal cointegrator 1 complex subunit 2 89.82
d1vdla_80 Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (M 89.67
d1ip9a_85 Bud emergence mediator Bemp1 {Baker's yeast (Sacch 89.62
d1ufza_83 HBS1-like protein {Mouse (Mus musculus) [TaxId: 10 87.21
d1h4ra384 Merlin {Human (Homo sapiens) [TaxId: 9606]} 86.28
d1wgra_100 Growth factor receptor-bound protein 7, GRB-7 {Hum 85.77
d1umqa_60 Photosynthetic apparatus regulatory protein PprA ( 85.35
d1oeya_82 Neutrophil cytosol factor 2 (p67phox component of 85.19
d1y8xb192 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 82.39
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Ubiquitin-like domain of Rad23 homolog B (Hhr23B)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.89  E-value=6.7e-23  Score=145.60  Aligned_cols=80  Identities=44%  Similarity=0.747  Sum_probs=74.1

Q ss_pred             CEEEEEeCCCcEEEEEeCCCCCHHHHHHHHHHHhCCCCCCCCCeEEEeCCeecCCCCcccccccCCCCeEEEEecccCCC
Q 029207            1 MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLADNKVSEDGFLVVMLSKSKTL   80 (197)
Q Consensus         1 M~I~Vk~~~g~~~~iev~~~~TV~~LK~~I~~~~g~~~~p~~~qrLi~~Gk~L~D~~tL~~~~I~~~~~I~l~~~~~~~~   80 (197)
                      |+|+||+++|++|.|+|++++||.+||++|+++.|.+.+++++|||||+||+|+|+++|++|||+++++|+|++++++..
T Consensus         1 M~I~vk~~~g~~~~l~v~~~~TV~~lK~~i~~~~~~~~i~~~~qrLi~~Gk~L~d~~tL~~y~I~~~s~i~lv~~~~~~~   80 (95)
T d1uela_           1 MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAV   80 (95)
T ss_dssp             CEEEEEETTCCEEEEECCTTSBHHHHHHHHHHHHCTTTCCTTTEEEEETTEECCTTSBGGGGTCCSSSEEEEEESSCCCC
T ss_pred             CEEEEEeCCCCEEEEEECCCccHHHHHHHHHhhhcccCCCccceEEEECCeEccCCCcHHHcCCCCCCEEEEEECCCCCC
Confidence            99999999999999999999999999999999887444889999999999999999999999999999999999775543



>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2k0bx1 a.5.2.1 (X:1-52) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cuka1 a.5.1.1 (A:156-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2di0a1 a.5.2.4 (A:8-70) Activating signal cointegrator 1 complex subunit 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ufza_ a.5.9.1 (A:) HBS1-like protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1umqa_ a.4.1.12 (A:) Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1oeya_ d.15.2.2 (A:) Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure