Citrus Sinensis ID: 029213


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVRSYYQQFEEQQTQSLIDQRIKEHLGQTAAFQQVGAAYNQHLLAQRPRLPVLPTPVMPMTGSAPLVPGMRPPVLPRPGPSPPGYVSAPGMPPMMAPPGAPSAPGQLNGFPRPPAVMNPTAVSGSAAPPASSSGAPSMATPQTYQANPTVPTSGNLNAQAPEMNH
cccccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVRSYYQQFEEQQTQSLIDQRIKEHLGQTAAFQQVGAAYNQHLLAQRPRL*V*****************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVRSYYQQFEEQQTQSLIDQRIKEHLGQTAAFQQVGAAYNQHLLAQRPRLPVLPTPVMPMTGSAPLVPGMRPPVLPRPGPSPPGYVSAPGMPPMMAPPGAPSAPGQLNGFPRPPAVMNPTAVSGSAAPPASSSGAPSMATPQTYQANPTVPTSGNLNAQAPEMNH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
U1 small nuclear ribonucleoprotein C Component of the U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. U1-C is directly involved in initial 5' splice-site recognition for both constitutive and regulated alternative splicing. The interaction with the 5' splice-site seems to precede base-pairing between the pre-mRNA and the U1 snRNA. Stimulates E complex formation by stabilizing the base pairing of the 5' end of the U1 snRNA and the 5' splice-site region.confidentF6HQ26
U1 small nuclear ribonucleoprotein C Component of the U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. U1-C is directly involved in initial 5' splice-site recognition for both constitutive and regulated alternative splicing. The interaction with the 5' splice-site seems to precede base-pairing between the pre-mRNA and the U1 snRNA. Stimulates E complex formation by stabilizing the base pairing of the 5' end of the U1 snRNA and the 5' splice-site region.probableQ56XE4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CW1, chain L
Confidence level:very confident
Coverage over the Query: 4-52
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 137-148
View the alignment between query and template
View the model in PyMOL