Citrus Sinensis ID: 029248


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190------
MAEKPQPVRVLYCSICSLPAEYCEFGPDFEKCKPWLIKNAPELYPDLLKEANEKEAEKVSGQLQLFGLSSGGADGATSGQTSSSKQEEVKRLPGGKIKKKERQEVVIEKVVRNKRKCITIVKGLDLFGVKLSDASKKLGKKFATGASVVKGPTEKEQIDVQGDISYDIVEFITDTWPAVPETAIYFIEDGKKVAAA
cccccccEEEEEccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHccccccccccccEEEEEEEEEcccEEEEEEEccccccccHHHHHHHHHHHcccccEEEEccccccEEEEcccHHHHHHHHHHHHccccccccEEEcccccccccc
****PQPVRVLYCSICSLPAEYCEFGPDFEKCKPWLIKNAPELYPDLLK*******************************************************VVIEKVVRNKRKCITIVKGLDLFGVKLSDASKKLGKKFATGASVVKGPTEKEQIDVQGDISYDIVEFITDTWPAVPETAIYFIEDGKK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEKPQPVRVLYCSICSLPAEYCEFGPDFEKCKPWLIKNAPELYPDLLKEANEKEAEKVSGQLQLFGLSSGGADGATSGQTSSSKQEEVKRLPGGKIKKKERQEVVIEKVVRNKRKCITIVKGLDLFGVKLSDASKKLGKKFATGASVVKGPTEKEQIDVQGDISYDIVEFITDTWPAVPETAIYFIEDGKKVAAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Density-regulated protein May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon.probableQ5ZJ39
Translation machinery-associated protein 22 probableP47089
Density-regulated protein homolog probableQ9NAH4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OGH, chain A
Confidence level:confident
Coverage over the Query: 99-188
View the alignment between query and template
View the model in PyMOL