Citrus Sinensis ID: 029255

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190------

MQDPREEVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARKGYVQNFLQKEAGDSPIDAAA

cccccccEEEEEECccccccccccccccccccccHHHHHHccCEEEEEcccccccHHHHHHHHHHccccCEEEEEEcccccccHHHHHHcHHHcEEcccEEEEEEEEEEEEEEEECcccEEEEEEEEcccEEEcccccEEEEECcccccEEEEEECcccccEECccccccccHHHHHHHHHHHHcccccccccccc

*****EE**QAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARKGYVQNFLQKEA*********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MQDPREEVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARKGYVQNFLQKEAGDSPIDAAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 3	Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).	confident	Q8W108
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2	Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).	confident	Q8GXE2
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2	Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).	confident	Q10RE5

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VR3, chain A
Confidence level:very confident
Coverage over the Query: 9-184
View the alignment between query and template
View the model in PyMOL