Citrus Sinensis ID: 029255

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190------
MQDPREEVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARKGYVQNFLQKEAGDSPIDAAA
cccccccEEEEEEEccccccccccccccccccccHHHHHHHcEEEEEEcccccccHHHHHHHHHHccccEEEEEEEcccccccHHHHHHcHHHcEEcccEEEEEEEEEEEEEEEEEcccEEEEEEEEcccEEEcccccEEEEEEcccccEEEEEEEcccccEEEccccccccHHHHHHHHHHHHcccccccccccc
ccccHHHHHHHHHcccccccccccccccccccccHHHHHHcccEEEEEccccccccHHHHHHHHHccccccEEEEEcHHHcccHHHHHHHHHHHHHcccHHHHEEEccccEEEEccccccEEEEEEEcccEEEEccccEEEEEcccccHEEEHHHcccccEEccccccccccHHHHHHHHHHHHccccccHEHccc
MQDPREEVIQAWymddsdedqrlphhkdpkefvsldqlselgvlswrldadnyetDEELKKIRedrgysymdfcevcpeklpnYEEKIKNFFEEhlhtdeeirycvagsgyfdvrdRNEKWIRIWVKkggmivlpagcyhrftldtDNYIKAMRLfvgdpvwtpfnrphdhlparkgYVQNFlqkeagdspidaaa
MQDPREEVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSElgvlswrldadnyetdeELKKiredrgysyMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGsgyfdvrdrNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARKGYVQNFLqkeagdspidaaa
MQDPREEVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARKGYVQNFLQKEAGDSPIDAAA
***********W********************VSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARKGYVQNF**************
*****EE**QAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARKGYVQNFLQKEA*********
MQDPREEVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARKGYVQNFLQKEAG********
****REEVIQAWYMDDS**D*RLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARKGYVQNFLQKE**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQDPREEVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARKGYVQNFLQKEAGDSPIDAAA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query196 2.2.26 [Sep-21-2011]
F6HDT7199 1,2-dihydroxy-3-keto-5-me yes no 1.0 0.984 0.857 1e-99
Q8W108199 1,2-dihydroxy-3-keto-5-me yes no 0.994 0.979 0.841 4e-97
Q8GXE2192 1,2-dihydroxy-3-keto-5-me yes no 0.933 0.953 0.874 3e-95
O48707199 1,2-dihydroxy-3-keto-5-me no no 0.989 0.974 0.789 9e-91
Q10RE5198 1,2-dihydroxy-3-keto-5-me yes no 0.984 0.974 0.757 9e-88
A2XCT8198 1,2-dihydroxy-3-keto-5-me N/A no 0.984 0.974 0.757 9e-88
A1L4T4199 1,2-dihydroxy-3-keto-5-me no no 0.989 0.974 0.731 3e-85
A2Z7C4199 1,2-dihydroxy-3-keto-5-me N/A no 0.989 0.974 0.731 3e-85
C5WWY0181 1,2-dihydroxy-3-keto-5-me N/A no 0.918 0.994 0.773 2e-82
C5X1F5180 1,2-dihydroxy-3-keto-5-me N/A no 0.887 0.966 0.793 3e-81
>sp|F6HDT7|MTND2_VITVI 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 OS=Vitis vinifera GN=VIT_05s0020g04080 PE=3 SV=1 Back     alignment and function desciption
 Score =  361 bits (927), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 168/196 (85%), Positives = 185/196 (94%)

Query: 1   MQDPREEVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELK 60
            +D REEV+QAWYMDDSDEDQRLPHH+DPKEFVSLDQL++LGVLSWRLDADNYETDEELK
Sbjct: 4   FKDDREEVLQAWYMDDSDEDQRLPHHRDPKEFVSLDQLAKLGVLSWRLDADNYETDEELK 63

Query: 61  KIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEK 120
           KIRE RGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRD+N+ 
Sbjct: 64  KIREARGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDQNDS 123

Query: 121 WIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARKGYVQ 180
           WIR+W+KKGGMIVLPAG YHRFTLD++NYIKAMRLFVGDPVWTPFNRPHD+LPAR+ Y++
Sbjct: 124 WIRVWLKKGGMIVLPAGIYHRFTLDSNNYIKAMRLFVGDPVWTPFNRPHDNLPARQEYLE 183

Query: 181 NFLQKEAGDSPIDAAA 196
            F QKEA +  +DAAA
Sbjct: 184 AFGQKEAANHVVDAAA 199
Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).
Vitis vinifera (taxid: 29760)
EC: 1EC: .EC: 1EC: 3EC: .EC: 1EC: 1EC: .EC: 5EC: 4
>sp|Q8W108|MTND3_ARATH 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 3 OS=Arabidopsis thaliana GN=ARD3 PE=2 SV=1 Back     alignment and function description
>sp|Q8GXE2|MTND2_ARATH 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 OS=Arabidopsis thaliana GN=ARD2 PE=2 SV=1 Back     alignment and function description
>sp|O48707|MTND1_ARATH 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 1 OS=Arabidopsis thaliana GN=ARD1 PE=2 SV=1 Back     alignment and function description
>sp|Q10RE5|MTND2_ORYSJ 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 OS=Oryza sativa subsp. japonica GN=ARD2 PE=2 SV=1 Back     alignment and function description
>sp|A2XCT8|MTND2_ORYSI 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 OS=Oryza sativa subsp. indica GN=ARD2 PE=2 SV=2 Back     alignment and function description
>sp|A1L4T4|MTND1_ORYSJ 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 1 OS=Oryza sativa subsp. japonica GN=ARD1 PE=2 SV=1 Back     alignment and function description
>sp|A2Z7C4|MTND1_ORYSI 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 1 OS=Oryza sativa subsp. indica GN=ARD1 PE=1 SV=2 Back     alignment and function description
>sp|C5WWY0|MTND2_SORBI 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase homolog 2 OS=Sorghum bicolor GN=Sb01g046360 PE=3 SV=1 Back     alignment and function description
>sp|C5X1F5|MTND1_SORBI 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 1 OS=Sorghum bicolor GN=Sb01g021500 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query196
255552053200 acireductone dioxygenase, putative [Rici 0.994 0.975 0.887 1e-101
297737108212 unnamed protein product [Vitis vinifera] 1.0 0.924 0.857 5e-98
363805401199 RecName: Full=1,2-dihydroxy-3-keto-5-met 1.0 0.984 0.857 7e-98
147858661195 hypothetical protein VITISV_012500 [Viti 0.989 0.994 0.865 1e-97
359477561 373 PREDICTED: 1,2-dihydroxy-3-keto-5-methyl 0.994 0.522 0.861 2e-97
407930079200 acireductone dioxygenase [Capsicum annuu 0.994 0.975 0.841 4e-97
297800752199 ATARD2 [Arabidopsis lyrata subsp. lyrata 0.994 0.979 0.852 9e-97
158325159200 acireductone dioxygenase [Solanum tubero 0.994 0.975 0.841 1e-96
18414289199 1,2-dihydroxy-3-keto-5-methylthiopentene 0.994 0.979 0.841 2e-95
37791221195 ARD-like protein [Brassica juncea] 0.969 0.974 0.857 2e-95
>gi|255552053|ref|XP_002517071.1| acireductone dioxygenase, putative [Ricinus communis] gi|223543706|gb|EEF45234.1| acireductone dioxygenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 173/195 (88%), Positives = 184/195 (94%)

Query: 2   QDPREEVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKK 61
           +DPREEVIQAWYMD SDEDQRLPHHKDPKEFVSLDQLSELGVLSWRL+ADNYETDEELKK
Sbjct: 6   KDPREEVIQAWYMDTSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLNADNYETDEELKK 65

Query: 62  IREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKW 121
           IRE+RGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRD N++W
Sbjct: 66  IREERGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDHNDRW 125

Query: 122 IRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARKGYVQN 181
           IR+WVKKGGMIVLPAG YHRFTLDTDNYIKAMRLFVGDP+WTPFNRPHDHLPARK Y++ 
Sbjct: 126 IRVWVKKGGMIVLPAGIYHRFTLDTDNYIKAMRLFVGDPIWTPFNRPHDHLPARKEYIKA 185

Query: 182 FLQKEAGDSPIDAAA 196
           F+QKE     +DA A
Sbjct: 186 FVQKEVDHQAVDATA 200

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297737108|emb|CBI26309.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|363805401|sp|F6HDT7.1|MTND2_VITVI RecName: Full=1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2; AltName: Full=Acireductone dioxygenase (Fe(2+)-requiring) 2; Short=ARD 2; Short=Fe-ARD 2 Back     alignment and taxonomy information
>gi|147858661|emb|CAN80823.1| hypothetical protein VITISV_012500 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359477561|ref|XP_003631995.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|407930079|gb|AFU51538.1| acireductone dioxygenase [Capsicum annuum] Back     alignment and taxonomy information
>gi|297800752|ref|XP_002868260.1| ATARD2 [Arabidopsis lyrata subsp. lyrata] gi|297314096|gb|EFH44519.1| ATARD2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|158325159|gb|ABW34717.1| acireductone dioxygenase [Solanum tuberosum] Back     alignment and taxonomy information
>gi|18414289|ref|NP_567441.1| 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 3 [Arabidopsis thaliana] gi|145323146|ref|NP_001031640.2| 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 3 [Arabidopsis thaliana] gi|75248589|sp|Q8W108.1|MTND3_ARATH RecName: Full=1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 3; AltName: Full=Acireductone dioxygenase (Fe(2+)-requiring) 3; Short=ARD 3; Short=Fe-ARD 3 gi|18087553|gb|AAL58908.1|AF462818_1 AT4g14710/dl3395c [Arabidopsis thaliana] gi|21555216|gb|AAM63805.1| submergence induced protein 2A [Arabidopsis thaliana] gi|58331819|gb|AAW70407.1| At4g14710 [Arabidopsis thaliana] gi|332658079|gb|AEE83479.1| 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 3 [Arabidopsis thaliana] gi|332658080|gb|AEE83480.1| 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|37791221|gb|AAR03591.1| ARD-like protein [Brassica juncea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query196
TAIR|locus:505006465192 ARD1 "acireductone dioxygenase 0.933 0.953 0.874 3.5e-91
TAIR|locus:2066321199 ARD3 "acireductone dioxygenase 0.989 0.974 0.789 2.9e-87
TAIR|locus:2170842187 ARD4 [Arabidopsis thaliana (ta 0.903 0.946 0.683 3.7e-71
UNIPROTKB|I3LEI8179 ADI1 "Uncharacterized protein" 0.892 0.977 0.659 2.3e-64
UNIPROTKB|Q3ZBL1179 ADI1 "1,2-dihydroxy-3-keto-5-m 0.913 1.0 0.638 6.9e-63
RGD|727828179 Adi1 "acireductone dioxygenase 0.913 1.0 0.644 1.4e-62
UNIPROTKB|Q5ZL43180 ADI1 "1,2-dihydroxy-3-keto-5-m 0.913 0.994 0.65 2.3e-62
MGI|MGI:2144929179 Adi1 "acireductone dioxygenase 0.913 1.0 0.65 2.3e-62
UNIPROTKB|Q6DIY2179 adi1 "1,2-dihydroxy-3-keto-5-m 0.892 0.977 0.642 1e-61
UNIPROTKB|Q9BV57179 ADI1 "1,2-dihydroxy-3-keto-5-m 0.913 1.0 0.627 1.6e-61
TAIR|locus:505006465 ARD1 "acireductone dioxygenase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 909 (325.0 bits), Expect = 3.5e-91, P = 3.5e-91
 Identities = 160/183 (87%), Positives = 175/183 (95%)

Query:     1 MQDPREEVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELK 60
             ++D REEVIQAWYMDDS+EDQRLPHHKDPKEFVSLD+L+ELGVLSWRLDADNYETDE+LK
Sbjct:     5 VKDGREEVIQAWYMDDSEEDQRLPHHKDPKEFVSLDKLAELGVLSWRLDADNYETDEDLK 64

Query:    61 KIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEK 120
             KIRE RGYSYMDFCEVCPEKLPNYE K+K+FFEEHLHTDEEIRYCVAG+GYFDVRDRNE 
Sbjct:    65 KIRESRGYSYMDFCEVCPEKLPNYEVKVKSFFEEHLHTDEEIRYCVAGTGYFDVRDRNEA 124

Query:   121 WIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARKGYVQ 180
             WIR+ VKKGGMIVLPAG YHRFT+D+DNYIKAMRLFVG+PVWTP+NRPHDHLPARK YV 
Sbjct:   125 WIRVLVKKGGMIVLPAGIYHRFTVDSDNYIKAMRLFVGEPVWTPYNRPHDHLPARKEYVD 184

Query:   181 NFL 183
             NF+
Sbjct:   185 NFM 187
GO:0005886 "plasma membrane" evidence=ISM
GO:0010309 "acireductone dioxygenase [iron(II)-requiring
GO:0046872 "metal ion binding" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005829 "cytosol" evidence=RCA
GO:0005506 "iron ion binding" evidence=IDA
GO:0051302 "regulation of cell division" evidence=IMP
TAIR|locus:2066321 ARD3 "acireductone dioxygenase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170842 ARD4 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|I3LEI8 ADI1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBL1 ADI1 "1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|727828 Adi1 "acireductone dioxygenase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZL43 ADI1 "1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2144929 Adi1 "acireductone dioxygenase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DIY2 adi1 "1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BV57 ADI1 "1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
E0W481MTND_PEDHC1, ., 1, 3, ., 1, 1, ., 5, 40.52800.90300.9833N/Ano
Q5KD76MTND_CRYNJ1, ., 1, 3, ., 1, 1, ., 5, 40.45600.87240.9144yesno
A9VCM7MTND_MONBE1, ., 1, 3, ., 1, 1, ., 5, 40.51130.87750.9772N/Ano
Q6DIY2MTND_XENTR1, ., 1, 3, ., 1, 1, ., 5, 40.63270.90300.9888yesno
Q6AWN0MTND_DROME1, ., 1, 3, ., 1, 1, ., 5, 40.50540.90300.9516yesno
Q5AQA3MTND_EMENI1, ., 1, 3, ., 1, 1, ., 5, 40.44630.85200.9382yesno
Q6CH03MTND_YARLI1, ., 1, 3, ., 1, 1, ., 5, 40.43020.82650.9364yesno
Q8W108MTND3_ARATH1, ., 1, 3, ., 1, 1, ., 5, 40.84180.99480.9798yesno
A2XCT8MTND2_ORYSI1, ., 1, 3, ., 1, 1, ., 5, 40.75770.98460.9747N/Ano
Q5ZL43MTND_CHICK1, ., 1, 3, ., 1, 1, ., 5, 40.650.91320.9944yesno
B7PRF6MTND_IXOSC1, ., 1, 3, ., 1, 1, ., 5, 40.63120.90300.9672N/Ano
O48707MTND1_ARATH1, ., 1, 3, ., 1, 1, ., 5, 40.78970.98970.9748nono
F6W3G8MTND_CIOIN1, ., 1, 3, ., 1, 1, ., 5, 40.48900.88770.9456yesno
Q99JT9MTND_MOUSE1, ., 1, 3, ., 1, 1, ., 5, 40.650.91321.0yesno
Q8GXE2MTND2_ARATH1, ., 1, 3, ., 1, 1, ., 5, 40.87430.93360.9531yesno
Q03677MTND_YEAST1, ., 1, 3, ., 1, 1, ., 5, 40.44570.80610.8826yesno
Q10RE5MTND2_ORYSJ1, ., 1, 3, ., 1, 1, ., 5, 40.75770.98460.9747yesno
Q3ZBL1MTND_BOVIN1, ., 1, 3, ., 1, 1, ., 5, 40.63880.91321.0yesno
Q3B8C8MTND_XENLA1, ., 1, 3, ., 1, 1, ., 5, 40.63330.91321.0N/Ano
A9SDW6MTND1_PHYPA1, ., 1, 3, ., 1, 1, ., 5, 40.70450.89790.9072N/Ano
A1L4T4MTND1_ORYSJ1, ., 1, 3, ., 1, 1, ., 5, 40.73190.98970.9748nono
C5WWY0MTND2_SORBI1, ., 1, 3, ., 1, 1, ., -0.77340.91830.9944N/Ano
A9SS00MTND2_PHYPA1, ., 1, 3, ., 1, 1, ., 5, 40.67020.95910.9641N/Ano
Q2LZI9MTND_DROPS1, ., 1, 3, ., 1, 1, ., 5, 40.52840.88770.9304yesno
A2Z7C4MTND1_ORYSI1, ., 1, 3, ., 1, 1, ., 5, 40.73190.98970.9748N/Ano
C3ZAH2MTND_BRAFL1, ., 1, 3, ., 1, 1, ., 5, 40.67420.88260.9774yesno
Q9BV57MTND_HUMAN1, ., 1, 3, ., 1, 1, ., 5, 40.62770.91321.0yesno
A9SCJ6MTND3_PHYPA1, ., 1, 3, ., 1, 1, ., 5, 40.67190.96420.9310N/Ano
Q562C9MTND_RAT1, ., 1, 3, ., 1, 1, ., 5, 40.64440.91321.0yesno
F6HDT7MTND2_VITVI1, ., 1, 3, ., 1, 1, ., 5, 40.85711.00.9849yesno
C5X1F5MTND1_SORBI1, ., 1, 3, ., 1, 1, ., 5, 40.79310.88770.9666N/Ano
F7FKV1MTND_MONDO1, ., 1, 3, ., 1, 1, ., 5, 40.63480.90810.9944yesno
Q6PBX5MTND_DANRE1, ., 1, 3, ., 1, 1, ., 5, 40.59090.89280.9668yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.13.11.53LOW CONFIDENCE prediction!
3rd Layer1.13.11LOW CONFIDENCE prediction!
3rd Layer1.13.11.54LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
scaffold_703119.1
annotation not avaliable (199 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
fgenesh1_pm.C_scaffold_8001076
annotation not avaliable (519 aa)
•••  •• 0.744
fgenesh2_kg.3__2898__AT2G05830.1
annotation not avaliable (369 aa)
• •   • 0.626

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query196
pfam03079157 pfam03079, ARD, ARD/ARD' family 1e-80
COG1791181 COG1791, COG1791, Uncharacterized conserved protei 4e-39
pfam0788370 pfam07883, Cupin_2, Cupin domain 9e-06
>gnl|CDD|217357 pfam03079, ARD, ARD/ARD' family Back     alignment and domain information 
 Score =  236 bits (604), Expect = 1e-80
 Identities = 97/157 (61%), Positives = 119/157 (75%), Gaps = 2/157 (1%)

Query: 10  QAWYMDDS-DEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGY 68
           QAW MDDS   DQRLPHH  PKE    D+L++LGVL W+LDAD+ ET EEL +IR+ + Y
Sbjct: 1   QAWIMDDSPCGDQRLPHHTFPKEKAETDELAKLGVLYWKLDADDEETAEELLRIRKYKHY 60

Query: 69  SYMDF-CEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVK 127
             +D    VCPE  PN++EK+K FFEEHLHTDEEIRY V G+GYFDVRD+++ WIR++V+
Sbjct: 61  DDVDIDVTVCPETTPNFDEKLKKFFEEHLHTDEEIRYIVEGTGYFDVRDKDDVWIRVFVE 120

Query: 128 KGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTP 164
           KG +I LPAG YHRFT   DNY+KA+RLFV  P WT 
Sbjct: 121 KGDLISLPAGIYHRFTTTPDNYVKALRLFVTKPGWTA 157

The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+. ARD and ARD' can be experimentally interconverted by removal of the bound metal ion and reconstitution with the appropriate metal ion. The two enzymes share the same substrate, 1,2-dihydroxy-3-keto-5-(methylthio)pentene, but yield different products. ARD' yields the alpha-keto precursor of methionine (and formate), thus forming part of the ubiquitous methionine salvage pathway that converts 5'-methylthioadenosine (MTA) to methionine. This pathway is responsible for the tight control of the concentration of MTA, which is a powerful inhibitor of polyamine biosynthesis and transmethylation reactions. ARD yields methylthiopropanoate, carbon monoxide and formate, and thus prevents the conversion of MTA to methionine. The role of the ARD catalyzed reaction is unclear: methylthiopropanoate is cytotoxic, and carbon monoxide can activate guanylyl cyclase, leading to increased intracellular cGMP levels. This family also contains other members, whose functions are not well characterized. Length = 157
>gnl|CDD|224704 COG1791, COG1791, Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>gnl|CDD|219618 pfam07883, Cupin_2, Cupin domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 196
KOG2107179 consensus Uncharacterized conserved protein, conta 100.0
PF03079157 ARD: ARD/ARD' family; InterPro: IPR004313 The two 100.0
COG1791181 Uncharacterized conserved protein, contains double 100.0
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 98.93
COG1917131 Uncharacterized conserved protein, contains double 98.89
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 98.83
smart00835146 Cupin_1 Cupin. This family represents the conserve 98.75
PRK04190191 glucose-6-phosphate isomerase; Provisional 98.75
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 98.73
PF00190144 Cupin_1: Cupin; InterPro: IPR006045 This family re 98.7
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 98.62
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 98.62
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 98.61
PF02311136 AraC_binding: AraC-like ligand binding domain; Int 98.52
COG2140209 Thermophilic glucose-6-phosphate isomerase and rel 98.36
PRK13290125 ectC L-ectoine synthase; Reviewed 98.36
TIGR03404 367 bicupin_oxalic bicupin, oxalate decarboxylase fami 98.31
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 98.29
PF06560182 GPI: Glucose-6-phosphate isomerase (GPI); InterPro 98.29
PLN00212 493 glutelin; Provisional 98.17
PF02041167 Auxin_BP: Auxin binding protein; InterPro: IPR0005 98.09
COG4297163 Uncharacterized protein containing double-stranded 98.06
PRK11171266 hypothetical protein; Provisional 98.05
PRK13500 312 transcriptional activator RhaR; Provisional 98.05
PRK13501 290 transcriptional activator RhaR; Provisional 97.99
PRK10296 278 DNA-binding transcriptional regulator ChbR; Provis 97.96
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 97.9
PRK13503 278 transcriptional activator RhaS; Provisional 97.89
PRK13502 282 transcriptional activator RhaR; Provisional 97.89
PRK10371 302 DNA-binding transcriptional regulator MelR; Provis 97.88
COG4101142 Predicted mannose-6-phosphate isomerase [Carbohydr 97.87
PRK15457233 ethanolamine utilization protein EutQ; Provisional 97.82
TIGR02297 287 HpaA 4-hydroxyphenylacetate catabolism regulatory 97.79
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 97.71
COG3837161 Uncharacterized conserved protein, contains double 97.69
PF01050151 MannoseP_isomer: Mannose-6-phosphate isomerase; In 97.66
PF1297391 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ 97.66
TIGR02451215 anti_sig_ChrR anti-sigma factor, putative, ChrR fa 97.61
PLN00212493 glutelin; Provisional 97.6
COG3435 351 Gentisate 1,2-dioxygenase [Secondary metabolites b 97.58
PRK11171266 hypothetical protein; Provisional 97.55
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 97.54
TIGR02272 335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 97.46
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 97.43
PF06052151 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte 97.17
TIGR02272335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 96.99
PF06249152 EutQ: Ethanolamine utilisation protein EutQ; Inter 96.92
PF05523131 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 96.91
PF12852186 Cupin_6: Cupin 96.66
COG3450116 Predicted enzyme of the cupin superfamily [General 96.38
PRK10572 290 DNA-binding transcriptional regulator AraC; Provis 96.25
COG4766176 EutQ Ethanolamine utilization protein [Amino acid 96.06
PF04209 424 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR 95.83
PF02373114 JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 95.29
TIGR01015 429 hmgA homogentisate 1,2-dioxygenase. Missing in hum 95.26
PRK05341 438 homogentisate 1,2-dioxygenase; Provisional 94.87
COG3257264 GlxB Uncharacterized protein, possibly involved in 94.36
PLN02658 435 homogentisate 1,2-dioxygenase 94.23
KOG3995 279 consensus 3-hydroxyanthranilate oxygenase HAAO [Am 93.97
PRK09685 302 DNA-binding transcriptional activator FeaR; Provis 93.66
PF06339126 Ectoine_synth: Ectoine synthase; InterPro: IPR0104 92.92
PF14525172 AraC_binding_2: AraC-binding-like domain 92.88
PF13621251 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU 92.66
PF08007319 Cupin_4: Cupin superfamily protein; InterPro: IPR0 91.6
PF14499 251 DUF4437: Domain of unknown function (DUF4437); PDB 91.37
COG3435351 Gentisate 1,2-dioxygenase [Secondary metabolites b 90.85
PRK12335 287 tellurite resistance protein TehB; Provisional 90.47
PF07385225 DUF1498: Protein of unknown function (DUF1498); In 90.46
PF00908176 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer 90.43
COG3257264 GlxB Uncharacterized protein, possibly involved in 89.64
PF02678107 Pirin: Pirin; InterPro: IPR003829 This entry repre 89.56
PF04962261 KduI: KduI/IolB family; InterPro: IPR021120 The Kd 89.54
PF1169985 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. 88.92
TIGR01221176 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en 88.85
KOG2757411 consensus Mannose-6-phosphate isomerase [Carbohydr 88.69
COG3822225 ABC-type sugar transport system, auxiliary compone 88.51
COG3508 427 HmgA Homogentisate 1,2-dioxygenase [Secondary meta 87.18
TIGR00218302 manA mannose-6-phosphate isomerase, class I. The n 83.37
COG1898173 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela 82.15
COG1482312 ManA Phosphomannose isomerase [Carbohydrate transp 81.93
PF13759101 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB 80.04
>KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=5.2e-65  Score=414.98  Aligned_cols=177  Identities=71%  Similarity=1.302  Sum_probs=173.3

Q ss_pred             heeeEEecCC-CCCCCCCCCCCCCCcCCHhHHhhcCeEEEEeCCCCccChHHHHHHHHhcCCCeeeeEEECCCCCCChHH
Q 029255            8 VIQAWYMDDS-DEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEE   86 (196)
Q Consensus         8 m~~aw~~~~~-~~~~~l~~~~~p~~~v~~~~L~~~GV~~~~~~~~~~~~~~~i~~l~~~rGy~~~Dvv~l~p~~~p~~e~   86 (196)
                      ||+||||++. ++|||+|||.+|++.||+++|+++||+||++++++++.+.+|++|++++||+.+|+++++++++|||++
T Consensus         1 m~qaw~mdd~~~~D~RlPhh~~p~~~vs~d~L~~lGVly~kld~D~~e~~~~L~~lr~e~~~~~~d~~~~~~e~~~nfde   80 (179)
T KOG2107|consen    1 MMQAWYMDDSPCEDQRLPHHKDPKKEVSLDELARLGVLYWKLDADNYELDEELDRLREERGYSYMDICTVCPETLPNFDE   80 (179)
T ss_pred             CeeEEEcCCCCcccccCCCCCCCcccCCHHHHHhhCcEEEEecCchHHHHHHHHHHHHHcCCceeeEEEEchhhcccHHH
Confidence            8999999995 599999999999999999999999999999999999899999999999999999999999999999999


Q ss_pred             HhhccccccccCcceEEEEEeceEEEEEEeCCCeEEEEEEecCCEEEeCCCCeeeeeecCCCcEEEEEEecCCCceeecC
Q 029255           87 KIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFN  166 (196)
Q Consensus        87 ~~~~f~~eH~H~~dEiryil~G~g~f~v~~~~d~~~~i~~~~GDlI~VPaG~~H~F~~~~~~~~~alRlF~~~~gW~~~~  166 (196)
                      |+++||+||.|.++|||||++|+|||+|++.+|+||||.|++||||+|||||+||||++++++++|+|||.++|.|+|+|
T Consensus        81 Kvk~FfEEhlh~deeiR~il~GtgYfDVrd~dd~WIRi~vekGDlivlPaGiyHRFTtt~~n~vkamRlF~~~p~wta~n  160 (179)
T KOG2107|consen   81 KVKSFFEEHLHEDEEIRYILEGTGYFDVRDKDDQWIRIFVEKGDLIVLPAGIYHRFTTTPSNYVKAMRLFVGEPKWTAYN  160 (179)
T ss_pred             HHHHHHHHhcCchhheEEEeecceEEeeccCCCCEEEEEEecCCEEEecCcceeeeecCchHHHHHHHHhcCCcccccCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCchhHHHHHHHHhh
Q 029255          167 RPHDHLPARKGYVQNFLQ  184 (196)
Q Consensus       167 r~~d~~~~r~~yl~~~~~  184 (196)
                      ||+|..++|++||..|..
T Consensus       161 R~~d~l~~r~~yl~~i~~  178 (179)
T KOG2107|consen  161 RPHDELPARKQYLNFISQ  178 (179)
T ss_pred             CccccchhHHHHHhhccc
Confidence            999999999999998863

>PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] Back     alignment and domain information
>COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC Back     alignment and domain information
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) Back     alignment and domain information
>COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>PRK13500 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PRK13501 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PRK10296 DNA-binding transcriptional regulator ChbR; Provisional Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>PRK13503 transcriptional activator RhaS; Provisional Back     alignment and domain information
>PRK13502 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PRK10371 DNA-binding transcriptional regulator MelR; Provisional Back     alignment and domain information
>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15457 ethanolamine utilization protein EutQ; Provisional Back     alignment and domain information
>TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A Back     alignment and domain information
>TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine Back     alignment and domain information
>PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] Back     alignment and domain information
>PF12852 Cupin_6: Cupin Back     alignment and domain information
>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] Back     alignment and domain information
>PRK10572 DNA-binding transcriptional regulator AraC; Provisional Back     alignment and domain information
>COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism Back     alignment and domain information
>PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] Back     alignment and domain information
>TIGR01015 hmgA homogentisate 1,2-dioxygenase Back     alignment and domain information
>PRK05341 homogentisate 1,2-dioxygenase; Provisional Back     alignment and domain information
>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] Back     alignment and domain information
>PLN02658 homogentisate 1,2-dioxygenase Back     alignment and domain information
>KOG3995 consensus 3-hydroxyanthranilate oxygenase HAAO [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09685 DNA-binding transcriptional activator FeaR; Provisional Back     alignment and domain information
>PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins Back     alignment and domain information
>PF14525 AraC_binding_2: AraC-binding-like domain Back     alignment and domain information
>PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A Back     alignment and domain information
>PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors Back     alignment and domain information
>PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A Back     alignment and domain information
>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF07385 DUF1498: Protein of unknown function (DUF1498); InterPro: IPR010864 This family consists of several hypothetical bacterial proteins of around 225 residues in length Back     alignment and domain information
>PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 Back     alignment and domain information
>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] Back     alignment and domain information
>PF02678 Pirin: Pirin; InterPro: IPR003829 This entry represents N-terminal domain of Pirin proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF04962 KduI: KduI/IolB family; InterPro: IPR021120 The KduI/IolB family of enzymes includes 5-keto 4-deoxyuronate isomerase (KduI) and 5-deoxy-glucuronate isomerase (IolB) Back     alignment and domain information
>PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B Back     alignment and domain information
>TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase Back     alignment and domain information
>KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3822 ABC-type sugar transport system, auxiliary component [General function prediction only] Back     alignment and domain information
>COG3508 HmgA Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR00218 manA mannose-6-phosphate isomerase, class I Back     alignment and domain information
>COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1482 ManA Phosphomannose isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query196
1vr3_A191 Crystal Structure Of Acireductone Dioxygenase (1354 1e-61
1zrr_A179 Residual Dipolar Coupling Refinement Of Acireducton 1e-05
>pdb|1VR3|A Chain A, Crystal Structure Of Acireductone Dioxygenase (13543033) From Mus Musculus At 2.06 A Resolution Length = 191 Back     alignment and structure 
Iteration: 1

 Score =  232 bits (591), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 131/179 (73%), Gaps = 1/179 (0%)
Query: 9   IQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGY 68
           +QAWY D+S  D R PH   P   VSL+QL  LGVL W+LDAD YE D EL+KIR+ R Y
Sbjct: 14  VQAWYXDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKXRNY 73
Query: 69  SYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKK 128
           S+ D   +C + LPNYEEKIK FFEEHLH DEEIRY + GSGYFDVRD+ +KWIRI  +K
Sbjct: 74  SWXDIITICKDTLPNYEEKIKXFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISXEK 133
Query: 129 GGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARKGYVQNFLQKEA 187
           G  I LPAG YHRFTLD  NY+KA RLFVG+PVWTP+NRP DH  AR  Y  +FL+  A
Sbjct: 134 GDXITLPAGIYHRFTLDEKNYVKAXRLFVGEPVWTPYNRPADHFDARVQY-XSFLEGTA 191
>pdb|1ZRR|A Chain A, Residual Dipolar Coupling Refinement Of Acireductone Dioxygenase From Klebsiella Length = 179 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query196
1vr3_A191 Acireductone dioxygenase; 13543033, structural gen 1e-81
1zrr_A179 E-2/E-2' protein; nickel, cupin, beta helix, methi 2e-56
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 4e-06
2d40_A354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 2e-04
3d82_A102 Cupin 2, conserved barrel domain protein; structur 7e-06
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 1e-05
3nw4_A 368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 1e-05
3nw4_A368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 7e-05
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 1e-05
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 1e-04
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 3e-04
1vj2_A126 Novel manganese-containing cupin TM1459; structura 3e-04
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 3e-04
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 4e-04
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 4e-04
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 6e-04
1v70_A105 Probable antibiotics synthesis protein; structural 7e-04
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 7e-04
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 9e-04
>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 Length = 191 Back     alignment and structure
 Score =  239 bits (612), Expect = 1e-81
 Identities = 114/184 (61%), Positives = 134/184 (72%)

Query: 1   MQDPREEVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELK 60
           +      ++QAWYMD+S  D R PH   P   VSL+QL  LGVL W+LDAD YE D EL+
Sbjct: 6   IHHHHHHMVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELE 65

Query: 61  KIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEK 120
           KIR+ R YS+MD   +C + LPNYEEKIK FFEEHLH DEEIRY + GSGYFDVRD+ +K
Sbjct: 66  KIRKMRNYSWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDK 125

Query: 121 WIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARKGYVQ 180
           WIRI ++KG MI LPAG YHRFTLD  NY+KAMRLFVG+PVWTP+NRP DH  AR  Y+ 
Sbjct: 126 WIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMS 185

Query: 181 NFLQ 184
               
Sbjct: 186 FLEG 189
>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A Length = 179 Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Length = 354 Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Length = 354 Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Length = 102 Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Length = 107 Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* Length = 368 Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* Length = 368 Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Length = 145 Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Length = 116 Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Length = 126 Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Length = 163 Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Length = 115 Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Length = 113 Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445 Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Length = 105 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Length = 394 Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Length = 126 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query196
1vr3_A191 Acireductone dioxygenase; 13543033, structural gen 100.0
1zrr_A179 E-2/E-2' protein; nickel, cupin, beta helix, methi 100.0
1v70_A105 Probable antibiotics synthesis protein; structural 98.99
3h8u_A125 Uncharacterized conserved protein with double-STR 98.99
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 98.93
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 98.9
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 98.88
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 98.87
1yfu_A174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 98.84
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 98.84
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 98.84
1vj2_A126 Novel manganese-containing cupin TM1459; structura 98.83
4i4a_A128 Similar to unknown protein; structural genomics, P 98.83
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 98.83
2o8q_A134 Hypothetical protein; cpuin-like fold, structural 98.82
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 98.82
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 98.81
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 98.81
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 98.81
3d82_A102 Cupin 2, conserved barrel domain protein; structur 98.81
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 98.79
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 98.77
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 98.77
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 98.75
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 98.74
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 98.74
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 98.73
3d0j_A140 Uncharacterized protein CA_C3497; beta-barrel, str 98.73
2q30_A110 Uncharacterized protein; double-stranded beta-heli 98.72
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 98.7
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 98.69
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 98.68
3lwc_A119 Uncharacterized protein; structural genomics, unkn 98.67
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 98.67
1zvf_A176 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 98.67
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 98.66
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 98.65
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 98.64
3rns_A227 Cupin 2 conserved barrel domain protein; structura 98.61
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 98.61
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 98.59
4h7l_A157 Uncharacterized protein; structural genomics, PSI- 98.58
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 98.58
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 98.57
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 98.57
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 98.57
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 98.55
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 98.55
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 98.55
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 98.55
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 98.54
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 98.54
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 98.52
3rns_A227 Cupin 2 conserved barrel domain protein; structura 98.49
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 98.48
1sef_A274 Conserved hypothetical protein; structural genomic 98.48
1juh_A 350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 98.46
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 98.46
3qac_A 465 11S globulin SEED storage protein; 11S SEED storag 98.44
2xlg_A239 SLL1785 protein, CUCA; metal binding protein, cupi 98.44
1fxz_A 476 Glycinin G1; proglycinin, legumin, SEED storage pr 98.43
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 98.42
2qnk_A 286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 98.42
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 98.4
3nw4_A 368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 98.4
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 98.39
3bcw_A123 Uncharacterized protein; structural genomics, join 98.39
1sfn_A246 Conserved hypothetical protein; structural genomic 98.39
2e9q_A 459 11S globulin subunit beta; cucubitin, pumpkin SEED 98.37
4axo_A151 EUTQ, ethanolamine utilization protein; structural 98.37
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 98.36
2d5f_A 493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 98.36
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 98.35
3c3v_A 510 Arachin ARAH3 isoform; peanut allergen, allergy, g 98.33
2phl_A 397 Phaseolin; plant SEED storage protein(vicilin); HE 98.31
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 98.31
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 98.3
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 98.3
3bu7_A 394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 98.3
1uij_A416 Beta subunit of beta conglycinin; double-stranded 98.3
2arc_A164 ARAC, arabinose operon regulatory protein; transcr 98.28
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HE 98.27
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 98.27
3ksc_A 496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 98.26
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 98.25
1juh_A350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 98.25
2vpv_A166 Protein MIF2, MIF2P; nucleus, mitosis, centromere, 98.24
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 98.24
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 98.21
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 98.2
3s7i_A418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 98.19
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 98.18
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 98.14
2o1q_A145 Putative acetyl/propionyl-COA carboxylase, alpha; 98.13
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 98.09
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 98.09
2d40_A354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 98.08
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, dom 98.01
3lag_A98 Uncharacterized protein RPA4178; functionally unkn 97.97
3kgl_A 466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 97.97
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 97.89
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 97.85
3ebr_A159 Uncharacterized RMLC-like cupin; structural genomi 97.84
2q1z_B195 Anti-sigma factor CHRR, transcriptional activator; 97.83
3es4_A116 Uncharacterized protein DUF861 with A RMLC-like C; 97.78
3nw4_A368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 97.77
1sef_A274 Conserved hypothetical protein; structural genomic 97.74
3gbg_A 276 TCP pilus virulence regulatory protein; cupin, hel 97.71
2y0o_A175 Probable D-lyxose ketol-isomerase; carbohydrate me 97.71
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 97.65
3fz3_A 531 Prunin; TREE NUT allergen, allergy, amandin, almon 97.59
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 97.31
3cjx_A165 Protein of unknown function with A cupin-like FOL; 97.29
1sfn_A246 Conserved hypothetical protein; structural genomic 97.26
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 97.24
3o14_A223 Anti-ecfsigma factor, CHRR; cupin, structural geno 97.23
3bal_A153 Acetylacetone-cleaving enzyme; jelly roll, tetrame 97.14
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 96.62
2pa7_A141 DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug 96.45
1nxm_A197 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell 95.6
1ep0_A185 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race 95.55
2ixk_A184 DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l 95.32
3ejk_A174 DTDP sugar isomerase; YP_390184.1, structural geno 95.27
1yud_A170 Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p 95.23
1dzr_A183 DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 95.22
3kmh_A246 D-lyxose isomerase; cupin beta-barrel, structural 95.18
3eqe_A171 Putative cystein deoxygenase; YUBC, SR112, NESG, s 95.15
3bb6_A127 Uncharacterized protein YEAR; structural genomics, 94.92
3ryk_A205 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat 94.8
2gm6_A208 Cysteine dioxygenase type I; structural genomics, 94.78
1eyb_A 471 Homogentisate 1,2-dioxygenase; jelly roll, beta sa 94.61
2c0z_A216 NOVW; isomerase, epimerase, antibiotic biosynthesi 94.33
3o14_A223 Anti-ecfsigma factor, CHRR; cupin, structural geno 94.02
4gjz_A235 Lysine-specific demethylase 8; JMJC, beta barrel, 93.35
2qnk_A286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 93.06
1wlt_A196 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 93.0
1oi6_A205 PCZA361.16; epimerase, vancomycin group antibiotic 92.81
1upi_A225 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat 92.13
2xdv_A 442 MYC-induced nuclear antigen; ribosome biogenesis, 91.7
4diq_A 489 Lysine-specific demethylase NO66; structural genom 91.45
3d8c_A349 Hypoxia-inducible factor 1 alpha inhibitor; FIH, H 90.77
2vec_A256 YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe 90.54
2qjv_A270 Uncharacterized IOLB-like protein; structural geno 90.49
1dgw_X79 Canavalin; duplicated swiss-roll beta barrels, loo 90.47
1vrb_A342 Putative asparaginyl hydroxylase; 2636534, structu 89.6
4hn1_A201 Putative 3-epimerase in D-allose pathway; 3'-monoe 88.27
1tq5_A242 Protein YHHW; bicupin, pirin, montreal-kingston ba 87.73
3eln_A200 Cysteine dioxygenase type 1; peroxysulfenate, non- 87.51
3al5_A338 HTYW5, JMJC domain-containing protein C2ORF60; tRN 87.49
3uss_A211 Putative uncharacterized protein; cupin, three his 83.37
1zx5_A300 Mannosephosphate isomerase, putative; STRU genomic 82.74
1qwr_A319 Mannose-6-phosphate isomerase; structural genomics 81.11
>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 Back     alignment and structure
Probab=100.00  E-value=7.5e-55  Score=363.61  Aligned_cols=178  Identities=64%  Similarity=1.146  Sum_probs=170.6

Q ss_pred             hheeeEEecCCCCCCCCCCCCCCCCcCCHhHHhhcCeEEEEeCCCCccChHHHHHHHHhcCCCeeeeEEECCCCCCChHH
Q 029255            7 EVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEE   86 (196)
Q Consensus         7 ~m~~aw~~~~~~~~~~l~~~~~p~~~v~~~~L~~~GV~~~~~~~~~~~~~~~i~~l~~~rGy~~~Dvv~l~p~~~p~~e~   86 (196)
                      -||+|||||++++|||+||+++|+++||+++|+++||+||+++++.++.+.+|++|++++||.+.|+++++++++||+++
T Consensus        12 ~~~~~~~~~~~~~d~~~ph~~~~~~~v~~~~L~~~GV~~w~~~~~~~~~~~~l~~l~~~~gy~~~D~v~~~p~~~p~~~~   91 (191)
T 1vr3_A           12 HMVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEE   91 (191)
T ss_dssp             -CCEEEEBCSCCSCTTSCCBCSSCCBCCHHHHHHTTCEEEECCGGGTTSCHHHHHHHHHHTCCEEEEEEESTTTSTTHHH
T ss_pred             hhheeeeccCCccccCcccccCCCCccCHHHHHhcCcEEEECCCccccccHHHHHHHHhcCCCceeEEEECCCcCcchhh
Confidence            59999999999999999999999999999999999999999988766678899999999999999999999997799999


Q ss_pred             HhhccccccccCcceEEEEEeceEEEEEEeCCCeEEEEEEecCCEEEeCCCCeeeeeecCCCcEEEEEEecCCCceeecC
Q 029255           87 KIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFN  166 (196)
Q Consensus        87 ~~~~f~~eH~H~~dEiryil~G~g~f~v~~~~d~~~~i~~~~GDlI~VPaG~~H~F~~~~~~~~~alRlF~~~~gW~~~~  166 (196)
                      |+++|+.+|+|+++|++||++|+|+|.+++.+++|+++.|++||+|+||+|++|||++++++++++||||.+++||+|++
T Consensus        92 k~~~~~~~H~H~~~Ei~yVleG~G~f~i~d~~d~~~~i~v~~GDlIiIPaG~~H~f~~~~~~~~~airlF~~~~~W~~~~  171 (191)
T 1vr3_A           92 KIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYN  171 (191)
T ss_dssp             HHHHHHSCEECSSCEEEEEEEEEEEEEEECTTSCEEEEEEETTEEEEECTTCCEEEEECTTCCEEEEEEESSSCCCCCEE
T ss_pred             hhccCCcceECCcceEEEEEeceEEEEECCCCCeEEEEEECCCCEEEECcCCcCCcccCCCCCEEEEEEECCCCCccCCC
Confidence            99999999999999999999999999999766889999999999999999999999999999999999999999999999


Q ss_pred             CCCCCchhHHHHHHHHhh
Q 029255          167 RPHDHLPARKGYVQNFLQ  184 (196)
Q Consensus       167 r~~d~~~~r~~yl~~~~~  184 (196)
                      ||+|++++|++||++|..
T Consensus       172 r~~~~~~~r~~y~~~~~~  189 (191)
T 1vr3_A          172 RPADHFDARVQYMSFLEG  189 (191)
T ss_dssp             SCCTTSHHHHHHHHHHHH
T ss_pred             CchhccHHHHHHHHHhhh
Confidence            999999999999999874
>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* Back     alignment and structure
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} Back     alignment and structure
>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} Back     alignment and structure
>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} Back     alignment and structure
>3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} Back     alignment and structure
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* Back     alignment and structure
>1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* Back     alignment and structure
>1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* Back     alignment and structure
>2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* Back     alignment and structure
>3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 Back     alignment and structure
>1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* Back     alignment and structure
>3kmh_A D-lyxose isomerase; cupin beta-barrel, structural genomics, montreal-kingston BA structural genomics initiative, BSGI; 1.58A {Escherichia coli O157} PDB: 3mpb_A* Back     alignment and structure
>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} Back     alignment and structure
>3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 Back     alignment and structure
>3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} Back     alignment and structure
>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 Back     alignment and structure
>1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A Back     alignment and structure
>2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 Back     alignment and structure
>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} Back     alignment and structure
>4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A Back     alignment and structure
>1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A Back     alignment and structure
>1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* Back     alignment and structure
>2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} Back     alignment and structure
>4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} Back     alignment and structure
>3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... Back     alignment and structure
>2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} Back     alignment and structure
>2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} Back     alignment and structure
>1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X Back     alignment and structure
>1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 Back     alignment and structure
>4hn1_A Putative 3-epimerase in D-allose pathway; 3'-monoepimerase, natural product, deoxysugar, chalcomycin, mycinose, cupin fold; HET: TYD THM; 1.60A {Streptomyces bikiniensis} PDB: 4hmz_A* 4hn0_A Back     alignment and structure
>1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 Back     alignment and structure
>3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A Back     alignment and structure
>3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* Back     alignment and structure
>3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 Back     alignment and structure
>1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 Back     alignment and structure
>1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 196
d1vr3a1179 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse 9e-87
d1zrra1179 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebs 4e-47
d2phda1351 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Ps 8e-09
d2phda1 351 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Ps 2e-04
d3bu7a1355 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Si 7e-07
d3bu7a1 355 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Si 0.001
d2d40a1308 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es 1e-05
d2d40a1 308 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es 7e-04
d1uika1203 b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb 2e-05
d1j58a_ 372 b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B 5e-04
d1dgwa_178 b.82.1.2 (A:) Seed storage 7S protein {Jack bean ( 6e-04
d1juha_ 348 b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill 0.001
d1uija1170 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea 0.002
d1x82a_190 b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI { 0.002
d1sq4a_273 b.82.1.11 (A:) Glyoxylate-induced protein PA1140 { 0.003
d1sfna_245 b.82.1.11 (A:) Hypothetical protein DR1152 {Deinoc 0.003
d2arca_161 b.82.4.1 (A:) Regulatory protein AraC {Escherichia 0.004
>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Acireductone dioxygenase
domain: Acireductone dioxygenase
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  251 bits (642), Expect = 9e-87
 Identities = 117/179 (65%), Positives = 137/179 (76%), Gaps = 1/179 (0%)

Query: 9   IQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGY 68
           +QAWYMD+S  D R PH   P   VSL+QL  LGVL W+LDAD YE D EL+KIR+ R Y
Sbjct: 2   VQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNY 61

Query: 69  SYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKK 128
           S+MD   +C + LPNYEEKIK FFEEHLH DEEIRY + GSGYFDVRD+ +KWIRI ++K
Sbjct: 62  SWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEK 121

Query: 129 GGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARKGYVQNFLQKEA 187
           G MI LPAG YHRFTLD  NY+KAMRLFVG+PVWTP+NRP DH  AR  Y+ +FL+  A
Sbjct: 122 GDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYM-SFLEGTA 179
>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Length = 179 Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351 Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351 Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Length = 355 Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Length = 355 Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178 Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348 Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 190 Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Length = 273 Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Length = 245 Back     information, alignment and structure
>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query196
d1vr3a1179 Acireductone dioxygenase {Mouse (Mus musculus) [Ta 100.0
d1zrra1179 Acireductone dioxygenase {Klebsiella pneumoniae [T 100.0
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 99.14
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 99.13
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 99.03
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 98.98
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc 98.94
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 98.94
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 98.87
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 98.82
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 98.77
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 98.73
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 98.72
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 98.72
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 98.72
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 98.69
d1uika1203 Seed storage 7S protein {Soybean (Glycine max), be 98.66
d2pyta1128 Ethanolamine utilization protein EutQ {Salmonella 98.65
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 98.65
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 98.65
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 98.64
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 98.62
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensi 98.61
d1uika2185 Seed storage 7S protein {Soybean (Glycine max), be 98.6
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 98.6
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 98.59
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 98.58
d1juha_ 348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 98.58
d1y3ta1330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 98.48
d2d40a1 308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 98.46
d2phda1 351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 98.46
d1j58a_ 372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 98.41
d2phla1200 Seed storage 7S protein {French bean (Phaseolus vu 98.38
d1y3ta1 330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 98.35
d1fxza1239 Seed storage 7S protein {Soybean (Glycine max), pr 98.2
d1juha_348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 98.17
d3bu7a1 355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 98.12
d1od5a1245 Seed storage 7S protein {Soybean (Glycine max), gl 98.11
d3bu7a1355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 98.11
d2d40a1308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 98.11
d2arca_161 Regulatory protein AraC {Escherichia coli [TaxId: 98.08
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 97.99
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 97.96
d2phda1351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 97.95
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 97.86
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 97.66
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 97.61
d1yfua1174 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m 97.48
d2pa7a1135 dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane 97.29
d1zvfa1175 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea 97.22
d2o1qa1144 Putative acetyl/propionyl-CoA carboxylase subunit 96.93
d1eyba_ 439 Homogentisate dioxygenase {Human (Homo sapiens) [T 96.26
d1vrba1319 Putative asparaginyl hydroxylase YxbC {Bacillus su 94.49
d1wlta1176 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 93.22
d2ixca1198 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac 91.42
d1dzra_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone 91.13
d1h2ka_335 Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum 91.05
d1nxma_194 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto 90.61
d1ep0a_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 90.53
d1pmia_440 Phosphomannose isomerase {Yeast (Candida albicans) 88.96
d1i5za2132 Catabolite gene activator protein, N-terminal doma 88.95
d2ixha1184 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom 88.65
d2c0za1190 Novobiocin biosynthesis protein NovW {Streptomyces 87.9
d1zx5a1299 Putative mannosephosphate isomerase AF0035 {Archae 87.42
d1oi6a_202 dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc 86.45
d1tq5a1231 Hypothetical protein YhhW {Escherichia coli [TaxId 83.78
d1qwra_315 Mannose-6-phosphate isomerase ManA {Bacillus subti 83.0
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 82.8
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 81.88
d3bb6a1109 Uncharacterized protein YeaR {Escherichia coli [Ta 81.09
d1zx5a1299 Putative mannosephosphate isomerase AF0035 {Archae 80.26
>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Acireductone dioxygenase
domain: Acireductone dioxygenase
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=1.8e-66  Score=427.69  Aligned_cols=177  Identities=64%  Similarity=1.151  Sum_probs=174.0

Q ss_pred             heeeEEecCCCCCCCCCCCCCCCCcCCHhHHhhcCeEEEEeCCCCccChHHHHHHHHhcCCCeeeeEEECCCCCCChHHH
Q 029255            8 VIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEEK   87 (196)
Q Consensus         8 m~~aw~~~~~~~~~~l~~~~~p~~~v~~~~L~~~GV~~~~~~~~~~~~~~~i~~l~~~rGy~~~Dvv~l~p~~~p~~e~~   87 (196)
                      ||+|||||++++|||+||+++|+++||+++|+++||.||+++++.++++++|++|++++||+++|+|+|+|+++||++++
T Consensus         1 m~~aw~~d~~~~d~r~ph~~~p~~~v~~~~L~~lGV~y~~~~~~~~~~~~~l~~l~~ergY~~~D~i~l~p~~~pn~~~~   80 (179)
T d1vr3a1           1 MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEEK   80 (179)
T ss_dssp             CCEEEEBCSCCSCTTSCCBCSSCCBCCHHHHHHTTCEEEECCGGGTTSCHHHHHHHHHHTCCEEEEEEESTTTSTTHHHH
T ss_pred             CceEEEecCCCcccccCcccCCCCccCHHHHHhhCCEEEEecCccccccHHHHHHHHhcCCCceEEEEECCccCCCHHHH
Confidence            89999999999999999999999999999999999999999999988999999999999999999999999999999999


Q ss_pred             hhccccccccCcceEEEEEeceEEEEEEeCCCeEEEEEEecCCEEEeCCCCeeeeeecCCCcEEEEEEecCCCceeecCC
Q 029255           88 IKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNR  167 (196)
Q Consensus        88 ~~~f~~eH~H~~dEiryil~G~g~f~v~~~~d~~~~i~~~~GDlI~VPaG~~H~F~~~~~~~~~alRlF~~~~gW~~~~r  167 (196)
                      +++|+.||+|+++|||||++|+|+|++++.+++|++|.|++||+|+||+|++|||+++++++++|||||++++||+|+||
T Consensus        81 ~~~F~~EH~H~~~Evr~vl~G~G~f~v~~~~~~~iri~~~~GDli~iPag~~HwFtl~~~~~v~aiRlF~~~~~W~~~~r  160 (179)
T d1vr3a1          81 IKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNR  160 (179)
T ss_dssp             HHHHHSCEECSSCEEEEEEEEEEEEEEECTTSCEEEEEEETTEEEEECTTCCEEEEECTTCCEEEEEEESSSCCCCCEES
T ss_pred             HHHHhhceeCCCcEEEEEEeCcEEEEEECCCCcEEEEEEeCCCEEEeCCCccEeccCCCCCCEEEEEEECCCCeeeEcCC
Confidence            99999999999999999999999999998889999999999999999999999999999999999999999999999999


Q ss_pred             CCCCchhHHHHHHHHhh
Q 029255          168 PHDHLPARKGYVQNFLQ  184 (196)
Q Consensus       168 ~~d~~~~r~~yl~~~~~  184 (196)
                      ++|++++|++||++|++
T Consensus       161 ~ad~~~~R~~Y~~~l~~  177 (179)
T d1vr3a1         161 PADHFDARVQYMSFLEG  177 (179)
T ss_dssp             CCTTSHHHHHHHHHHHH
T ss_pred             ChhhchHHHHHHHHhhc
Confidence            99999999999999874
>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} Back     information, alignment and structure
>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} Back     information, alignment and structure
>d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} Back     information, alignment and structure
>d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} Back     information, alignment and structure
>d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} Back     information, alignment and structure
>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure