Citrus Sinensis ID: 029260

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190------

MSDEMGASVPINGSDRNGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKVQFSL

cccccccccccccccccccEEEEEEcccCECcccccccccccHHHHHHHHHHHHHHHcccEEEEEEEEEEEEccccEEEEEEEcccEEEcccccccccccHHHHHHHHHHHHcccccccccccCEEEEEEEEECcccccccccccccccccccHcEEEEEEEEccccEEEECccccEEEEcccHHHcccccccccc

****************NGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKVQF**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSDEMGASVPINGSDRNGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKVQFSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cleavage and polyadenylation specificity factor subunit 5	Mediates sequence-specific recognition of 5'-UGUA-3' elements within the pre-mRNA. Component of the cleavage factor Im (CFIm) complex that plays a key role in pre-mRNA 3'-processing.	probable	Q55E68

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BHO, chain A
Confidence level:very confident
Coverage over the Query: 9-195
View the alignment between query and template
View the model in PyMOL