Citrus Sinensis ID: 029260

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190------
MSDEMGASVPINGSDRNGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKVQFSL
cccccccccccccccccccEEEEEEcccEEEccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEccccEEEEEEEcccEEEcccccccccccHHHHHHHHHHHHcccccccccccEEEEEEEEEEEccccccccccccccccccHHHEEEEEEEEccccEEEEEccccEEEEcccHHHHccccccccc
cccccccccccccccccccEEEEEEccccEcccccccccccccHHHHHHHHHHHHHHccccEEEEEEEEEEcccccEEEEEEEcccEEEcccccccccccHHHHHHHHHHHHccccccccccccEEHHHHHHHccccccccccccccccccccccEEEEEEEEccccEEEEcccccEEEEEEHHEEcccccEEEcc
msdemgasvpingsdrngyvvdiyplssyyfgskeaipfkdetLYNRVLRMKsnydahglRTCVEAVLLVELFKHPHLLLLQVRNSIfklpggrlrpgesdiygLKRKLTRKLslnedggevdwEVGEClgmwwkpdfetllfpyfppnvkrpkecTKLFLVKlpvsqkffvpknlkllavplcqihenhkvqfsl
msdemgasvpingsdrngyVVDIYPLSSYyfgskeaipfkDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIfklpggrlrpgesdiyglkrkltrklslnedggevDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQihenhkvqfsl
MSDEMGASVPINGSDRNGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNedggevdwevgeCLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKVQFSL
****************NGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHEN*******
******************YVVDIYPLSSYYFGSKEAI*****TL*NRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKVQF**
********VPINGSDRNGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKVQFSL
****************NGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKVQFS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDEMGASVPINGSDRNGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKVQFSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query196 2.2.26 [Sep-21-2011]
Q6DJE4227 Cleavage and polyadenylat N/A no 0.862 0.744 0.452 7e-40
Q5RAI8227 Cleavage and polyadenylat yes no 0.862 0.744 0.452 3e-39
O43809227 Cleavage and polyadenylat yes no 0.862 0.744 0.452 3e-39
Q3ZCA2227 Cleavage and polyadenylat yes no 0.862 0.744 0.452 3e-39
Q4KM65227 Cleavage and polyadenylat yes no 0.862 0.744 0.452 3e-39
Q9CQF3227 Cleavage and polyadenylat yes no 0.862 0.744 0.452 3e-39
Q7T3C6228 Cleavage and polyadenylat yes no 0.862 0.741 0.447 3e-39
Q55E68200 Cleavage and polyadenylat yes no 0.831 0.815 0.463 7e-36
>sp|Q6DJE4|CPSF5_XENLA Cleavage and polyadenylation specificity factor subunit 5 OS=Xenopus laevis GN=cpsf5 PE=2 SV=1 Back     alignment and function desciption
 Score =  163 bits (413), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 114/170 (67%), Gaps = 1/170 (0%)

Query: 20  VVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLL 79
            +++YPL++Y FG+KE +  KD ++  R  RM+  +D  G+R  VE VL+V   + PH+L
Sbjct: 36  TINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVL 95

Query: 80  LLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFE 139
           LLQ+  + FKLPGG L PGE ++ GLKR +T  L   +DG + DW + +C+G WW+P+FE
Sbjct: 96  LLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILG-RQDGVQQDWVIDDCIGNWWRPNFE 154

Query: 140 TLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHEN 189
              +PY P ++ +PKE  KLFLV+L     F VPKN KL+A PL ++++N
Sbjct: 155 PPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDN 204
Mediates sequence-specific recognition of 5'-UGUA-3' elements within the pre-mRNA. Component of the cleavage factor Im (CFIm) complex that plays a key role in pre-mRNA 3'-processing.
Xenopus laevis (taxid: 8355)
>sp|Q5RAI8|CPSF5_PONAB Cleavage and polyadenylation specificity factor subunit 5 OS=Pongo abelii GN=NUDT21 PE=2 SV=1 Back     alignment and function description
>sp|O43809|CPSF5_HUMAN Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens GN=NUDT21 PE=1 SV=1 Back     alignment and function description
>sp|Q3ZCA2|CPSF5_BOVIN Cleavage and polyadenylation specificity factor subunit 5 OS=Bos taurus GN=NUDT21 PE=2 SV=1 Back     alignment and function description
>sp|Q4KM65|CPSF5_RAT Cleavage and polyadenylation specificity factor subunit 5 OS=Rattus norvegicus GN=Nudt21 PE=2 SV=1 Back     alignment and function description
>sp|Q9CQF3|CPSF5_MOUSE Cleavage and polyadenylation specificity factor subunit 5 OS=Mus musculus GN=Nudt21 PE=2 SV=1 Back     alignment and function description
>sp|Q7T3C6|CPSF5_DANRE Cleavage and polyadenylation specificity factor subunit 5 OS=Danio rerio GN=cpsf5 PE=2 SV=1 Back     alignment and function description
>sp|Q55E68|CPSF5_DICDI Cleavage and polyadenylation specificity factor subunit 5 OS=Dictyostelium discoideum GN=cpsf5 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query196
363807126216 uncharacterized protein LOC100791216 [Gl 0.933 0.847 0.754 7e-79
255546065214 pre-mRNA cleavage factor im, 25kD subuni 0.908 0.831 0.783 3e-78
225444838284 PREDICTED: cleavage and polyadenylation 0.979 0.676 0.728 5e-76
297738624291 unnamed protein product [Vitis vinifera] 0.979 0.659 0.728 6e-76
18417474222 CFIM-25-like protein [Arabidopsis thalia 0.923 0.815 0.735 3e-75
449446606217 PREDICTED: cleavage and polyadenylation 0.877 0.792 0.790 9e-75
356558387233 PREDICTED: LOW QUALITY PROTEIN: cleavage 0.933 0.785 0.737 3e-74
224087967210 predicted protein [Populus trichocarpa] 0.913 0.852 0.725 5e-73
297799004223 hypothetical protein ARALYDRAFT_491776 [ 0.964 0.847 0.678 2e-71
388493122205 unknown [Medicago truncatula] 0.846 0.809 0.734 7e-68
>gi|363807126|ref|NP_001242595.1| uncharacterized protein LOC100791216 [Glycine max] gi|255640824|gb|ACU20695.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  298 bits (763), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 160/183 (87%)

Query: 10  PINGSDRNGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLL 69
           P +G+D      DIYPLSSYYFGSK+A+P KD TL +RVLRMKSNY A G+RTCVEAVLL
Sbjct: 17  PNSGNDDQSLEFDIYPLSSYYFGSKDAVPSKDLTLVDRVLRMKSNYAASGIRTCVEAVLL 76

Query: 70  VELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGEC 129
           VELFKHPHLLLLQ+RNSI+KLPGGRLRPGESD  GLKRKL RKLS+NEDG   +WEVGEC
Sbjct: 77  VELFKHPHLLLLQIRNSIYKLPGGRLRPGESDTDGLKRKLARKLSVNEDGDGSEWEVGEC 136

Query: 130 LGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHEN 189
           LGMWW+PDFETL++P+ PPNV++PKECTK+FLVKLP S+K  VPKN+++LAVPLCQ+HEN
Sbjct: 137 LGMWWRPDFETLMYPFIPPNVEKPKECTKVFLVKLPESRKLIVPKNMRVLAVPLCQVHEN 196

Query: 190 HKV 192
           HK 
Sbjct: 197 HKT 199

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255546065|ref|XP_002514092.1| pre-mRNA cleavage factor im, 25kD subunit, putative [Ricinus communis] gi|223546548|gb|EEF48046.1| pre-mRNA cleavage factor im, 25kD subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225444838|ref|XP_002279095.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297738624|emb|CBI27869.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|18417474|ref|NP_567835.1| CFIM-25-like protein [Arabidopsis thaliana] gi|15081674|gb|AAK82492.1| AT4g29820/F27B13_60 [Arabidopsis thaliana] gi|20147173|gb|AAM10303.1| AT4g29820/F27B13_60 [Arabidopsis thaliana] gi|21554114|gb|AAM63194.1| mRNA cleavage factor subunit-like protein [Arabidopsis thaliana] gi|332660282|gb|AEE85682.1| CFIM-25-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449446606|ref|XP_004141062.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like [Cucumis sativus] gi|449488056|ref|XP_004157928.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356558387|ref|XP_003547488.1| PREDICTED: LOW QUALITY PROTEIN: cleavage and polyadenylation specificity factor subunit 5-like [Glycine max] Back     alignment and taxonomy information
>gi|224087967|ref|XP_002308275.1| predicted protein [Populus trichocarpa] gi|222854251|gb|EEE91798.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297799004|ref|XP_002867386.1| hypothetical protein ARALYDRAFT_491776 [Arabidopsis lyrata subsp. lyrata] gi|297313222|gb|EFH43645.1| hypothetical protein ARALYDRAFT_491776 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|388493122|gb|AFK34627.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query196
TAIR|locus:2123919222 CFIM-25 "homolog of CFIM-25" [ 0.877 0.774 0.732 3.5e-68
TAIR|locus:2131839200 AT4G25550 [Arabidopsis thalian 0.867 0.85 0.511 5.6e-45
UNIPROTKB|Q3ZCA2227 NUDT21 "Cleavage and polyadeny 0.857 0.740 0.431 5.1e-35
UNIPROTKB|E2QUJ4227 NUDT21 "Uncharacterized protei 0.857 0.740 0.431 5.1e-35
UNIPROTKB|O43809227 NUDT21 "Cleavage and polyadeny 0.857 0.740 0.431 5.1e-35
UNIPROTKB|Q5RAI8227 NUDT21 "Cleavage and polyadeny 0.857 0.740 0.431 5.1e-35
UNIPROTKB|Q6DJE4227 cpsf5 "Cleavage and polyadenyl 0.857 0.740 0.431 5.1e-35
MGI|MGI:1915469227 Nudt21 "nudix (nucleoside diph 0.857 0.740 0.431 5.1e-35
RGD|1305766227 Nudt21 "nudix (nucleoside diph 0.857 0.740 0.431 5.1e-35
UNIPROTKB|E2R7S0234 LOC100684233 "Uncharacterized 0.857 0.717 0.431 8.3e-35
TAIR|locus:2123919 CFIM-25 "homolog of CFIM-25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 692 (248.7 bits), Expect = 3.5e-68, P = 3.5e-68
 Identities = 126/172 (73%), Positives = 145/172 (84%)

Query:    20 VVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLL 79
             +VD+YPLSSYYFGSKEA+  KDE + +RV+R+KSNY AHGLRTCVEAVLLVELFKHPH+L
Sbjct:    28 MVDLYPLSSYYFGSKEALRVKDEIISDRVIRLKSNYAAHGLRTCVEAVLLVELFKHPHVL 87

Query:    80 LLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNXXXXXXXXXXXXCLGMWWKPDFE 139
             LLQ RNSIFKLPGGRLRPGESDI GLKRKL  KLS+N            C+GMWW+P+FE
Sbjct:    88 LLQYRNSIFKLPGGRLRPGESDIEGLKRKLASKLSVNENVGVSGYEVGECIGMWWRPNFE 147

Query:   140 TLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHK 191
             TL++P+ PPN+K PKECTKLFLV+LPV Q+F VPKN KLLAVPLCQ+HEN K
Sbjct:   148 TLMYPFLPPNIKHPKECTKLFLVRLPVHQQFVVPKNFKLLAVPLCQLHENEK 199
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0010260 "organ senescence" evidence=RCA
TAIR|locus:2131839 AT4G25550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZCA2 NUDT21 "Cleavage and polyadenylation specificity factor subunit 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUJ4 NUDT21 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43809 NUDT21 "Cleavage and polyadenylation specificity factor subunit 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RAI8 NUDT21 "Cleavage and polyadenylation specificity factor subunit 5" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DJE4 cpsf5 "Cleavage and polyadenylation specificity factor subunit 5" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
MGI|MGI:1915469 Nudt21 "nudix (nucleoside diphosphate linked moiety X)-type motif 21" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305766 Nudt21 "nudix (nucleoside diphosphate linked moiety X)-type motif 21" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R7S0 LOC100684233 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q55E68CPSF5_DICDINo assigned EC number0.46380.83160.815yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00016513001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (291 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query196
pfam13869188 pfam13869, NUDIX_2, Nucleotide hydrolase 6e-95
cd04686131 cd04686, Nudix_Hydrolase_27, Members of the Nudix 7e-04
cd04690118 cd04690, Nudix_Hydrolase_31, Members of the Nudix 0.002
>gnl|CDD|206040 pfam13869, NUDIX_2, Nucleotide hydrolase Back     alignment and domain information 
 Score =  273 bits (701), Expect = 6e-95
 Identities = 103/172 (59%), Positives = 135/172 (78%), Gaps = 1/172 (0%)

Query: 20  VVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLL 79
           V+D+YPLS+Y FG+KEA+  KD ++  R+ R+K+NY+ +G+R  VE VLLV    HPH+L
Sbjct: 2   VIDLYPLSNYTFGTKEALVEKDISVAERLKRLKNNYEKNGMRRSVEGVLLVHRHGHPHVL 61

Query: 80  LLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFE 139
           LLQ+ N+ FKLPGGRLRPGE +I GLKRKL +KLS  EDG E DWEVGECLG WW+P+FE
Sbjct: 62  LLQIGNTFFKLPGGRLRPGEDEIEGLKRKLAKKLS-PEDGVEEDWEVGECLGEWWRPNFE 120

Query: 140 TLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHK 191
           T ++PY P ++ +PKEC KL+LV+LP   KF VPKN+KLLAVPL ++++N  
Sbjct: 121 TSMYPYLPAHITKPKECIKLYLVQLPEKCKFAVPKNMKLLAVPLFELYDNAA 172

Nudix hydrolases are found in all classes of organism and hydrolyse a wide range of organic pyrophosphates, including nucleoside di- and triphosphates, di-nucleoside and diphospho-inositol polyphosphates, nucleotide sugars and RNA caps, with varying degrees of substrate specificity. Length = 188
>gnl|CDD|240042 cd04686, Nudix_Hydrolase_27, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240046 cd04690, Nudix_Hydrolase_31, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 196
PF13869188 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 100.0
KOG1689221 consensus mRNA cleavage factor I subunit [RNA proc 100.0
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphospha 99.28
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase 99.21
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy 99.2
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of 99.19
PRK09438148 nudB dihydroneopterin triphosphate pyrophosphatase 99.17
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase 99.15
PRK15434159 GDP-mannose mannosyl hydrolase NudD; Provisional 99.14
PF00293134 NUDIX: NUDIX domain; InterPro: IPR000086 The gener 99.14
PRK15472141 nucleoside triphosphatase NudI; Provisional 99.12
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase 99.11
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase 99.11
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase 99.1
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase 99.1
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase 99.07
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member 99.07
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase 99.07
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase 99.07
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase 99.06
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann 99.05
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase 99.04
PLN02325144 nudix hydrolase 99.04
PLN02709222 nudix hydrolase 99.03
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase s 99.03
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophos 99.02
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase s 99.02
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a 99.02
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase 99.01
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase 99.01
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase 99.0
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase 99.0
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase 98.99
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt 98.99
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase 98.98
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase 98.97
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport a 98.96
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase s 98.95
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase 98.95
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase 98.93
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase 98.92
TIGR00586128 mutt mutator mutT protein. All proteins in this fa 98.92
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudi 98.91
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase 98.9
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphospha 98.89
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase s 98.89
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of 98.89
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Prov 98.88
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase 98.87
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase 98.86
PRK10707190 putative NUDIX hydrolase; Provisional 98.84
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomer 98.84
PRK05379340 bifunctional nicotinamide mononucleotide adenylylt 98.82
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase 98.82
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase s 98.8
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provision 98.79
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) 98.78
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase 98.78
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase 98.77
cd04663126 Nudix_Hydrolase_6 Members of the Nudix hydrolase s 98.76
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L 98.76
TIGR02705156 nudix_YtkD nucleoside triphosphatase YtkD. The fun 98.76
PRK15393180 NUDIX hydrolase YfcD; Provisional 98.72
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a membe 98.72
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydr 98.72
PRK00714156 RNA pyrophosphohydrolase; Reviewed 98.71
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase 98.69
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily o 98.63
PRK11762185 nudE adenosine nucleotide hydrolase NudE; Provisio 98.58
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase 98.55
cd04662126 Nudix_Hydrolase_5 Members of the Nudix hydrolase s 98.53
COG0494161 MutT NTP pyrophosphohydrolases including oxidative 98.5
PRK08999 312 hypothetical protein; Provisional 98.49
TIGR02150158 IPP_isom_1 isopentenyl-diphosphate delta-isomerase 98.39
PRK00241256 nudC NADH pyrophosphatase; Reviewed 98.37
KOG2839145 consensus Diadenosine and diphosphoinositol polyph 98.34
cd03670186 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) 98.27
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase s 98.22
TIGR00052185 nudix-type nucleoside diphosphatase, YffH/AdpP fam 98.2
PRK10729202 nudF ADP-ribose pyrophosphatase NudF; Provisional 98.02
PLN03143291 nudix hydrolase; Provisional 97.98
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteri 97.65
KOG3069246 consensus Peroxisomal NUDIX hydrolase [Replication 97.43
PLN02791 770 Nudix hydrolase homolog 97.4
PRK15009191 GDP-mannose pyrophosphatase NudK; Provisional 97.28
KOG3041225 consensus Nucleoside diphosphate-sugar hydrolase o 96.88
KOG0648295 consensus Predicted NUDIX hydrolase FGF-2 and rela 96.87
PLN02552247 isopentenyl-diphosphate delta-isomerase 96.78
KOG3084345 consensus NADH pyrophosphatase I of the Nudix fami 96.63
KOG4195275 consensus Transient receptor potential-related cha 96.61
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-fin 96.44
PLN02839372 nudix hydrolase 94.49
COG4119161 Predicted NTP pyrophosphohydrolase [DNA replicatio 93.23
PF14815114 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 91.15
>PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A Back     alignment and domain information 
Probab=100.00  E-value=1.1e-85  Score=551.41  Aligned_cols=176  Identities=56%  Similarity=1.044  Sum_probs=149.0

Q ss_pred             ceEEEeeCCceeeccccCCCCCChhHHHHHHHHHhhhccCCCeeEEEEEEEEecCCCCeEEEEEecCCeeecCCcccCCC
Q 029260           19 YVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPG   98 (196)
Q Consensus        19 ~~~~lYPl~nY~Fg~k~~~~ekd~sv~~rl~rl~~~y~~~GmRrsV~aVilvh~~~~phVLLlq~~~~~~~LPGGrl~~g   98 (196)
                      ++|+|||||||+||+||++.|||+|+++||+||+++|+++||||||+||||||+|+||||||||+++++|+||||++++|
T Consensus         1 ~~~~iYPlsnY~Fg~ke~~~ekd~s~~~rl~rl~~~y~~~GmRrsVe~Vllvh~h~~PHvLLLq~~~~~fkLPGg~l~~g   80 (188)
T PF13869_consen    1 QTIRIYPLSNYTFGTKEAQPEKDPSVAARLQRLKENYEKEGMRRSVEGVLLVHEHGHPHVLLLQIGNTFFKLPGGRLRPG   80 (188)
T ss_dssp             -EEEE-BGGGEEEEEES----SSSSHHHHHHHHHHHHHHHSSEEEEEEEEEEEETTEEEEEEEEETTTEEE-SEEE--TT
T ss_pred             CeEEEecccceeeccCCcccccccCHHHHHHHHHHHHHHhCCceEEEEEEEEecCCCcEEEEEeccCccccCCccEeCCC
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CChHHHHHHHHHHHhCCCCCCCccceEEeeeeeeeeccCCCcCCCCCCCCCCCCceeeeEEEEEEcCCceEEeeCCCCeE
Q 029260           99 ESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKL  178 (196)
Q Consensus        99 E~~~e~LkReL~EeLg~~~~~~~~~w~Vge~lg~WwRp~Fet~~yPYlP~Hit~pKE~~klylV~Lpe~~~f~vPkn~kL  178 (196)
                      |+|++||+|+|++.|+..+ +...+|+||||||+|||||||+.|||||||||||||||+|||+|||||+|.|+|||||||
T Consensus        81 E~e~~gLkrkL~~~l~~~~-~~~~~w~vge~l~~WwRp~Fe~~~YPYlP~HitkPKE~~klylV~Lpe~~~F~VPkn~kL  159 (188)
T PF13869_consen   81 EDEIEGLKRKLTEKLSPED-GVDPDWEVGECLGTWWRPNFEPFMYPYLPPHITKPKECIKLYLVQLPEKCLFAVPKNMKL  159 (188)
T ss_dssp             --HHHHHHHHHHHHHB-SS-SS----EEEEEEEEEEESSSSS--BSS--TT-SS-SEEEEEEEEE--SSEEEEEETTSEE
T ss_pred             CChhHHHHHHHHHHcCCCc-CCCCCcEecCEEEEEeCCCCCCCCCCCCCcccCChhheeEEEEEecCCCceEecCCCCeE
Confidence            9999999999999999964 567899999999999999999999999999999999999999999999999999999999


Q ss_pred             EecccceeecCcccccc
Q 029260          179 LAVPLCQIHENHKVQFS  195 (196)
Q Consensus       179 ~AvPLfelydN~~~y~~  195 (196)
                      +||||||||||+++||.
T Consensus       160 ~AvPLFeLydN~~~YG~  176 (188)
T PF13869_consen  160 VAVPLFELYDNAQRYGP  176 (188)
T ss_dssp             EEEEHHHHTTTHHHHHH
T ss_pred             EeecHhhhhcChhhcCc
Confidence            99999999999999984

...
>KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification] Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional Back     alignment and domain information
>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] Back     alignment and domain information
>PRK15472 nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02325 nudix hydrolase Back     alignment and domain information
>PLN02709 nudix hydrolase Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10707 putative NUDIX hydrolase; Provisional Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD Back     alignment and domain information
>PRK15393 NUDIX hydrolase YfcD; Provisional Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>PRK00714 RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] Back     alignment and domain information
>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information
>PLN03143 nudix hydrolase; Provisional Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair] Back     alignment and domain information
>PLN02791 Nudix hydrolase homolog Back     alignment and domain information
>PRK15009 GDP-mannose pyrophosphatase NudK; Provisional Back     alignment and domain information
>KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] Back     alignment and domain information
>KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN02552 isopentenyl-diphosphate delta-isomerase Back     alignment and domain information
>KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] Back     alignment and domain information
>KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN02839 nudix hydrolase Back     alignment and domain information
>COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query196
2cl3_A230 Crystal Structure Of Human Cleavage And Polyadenyla 2e-36
2j8q_A227 Crystal Structure Of Human Cleavage And Polyadenyla 2e-36
3mdg_A227 Crystal Structure Of The 25kda Subunit Of Human Cle 3e-36
3q2s_A207 Crystal Structure Of Cfim68 RrmCFIM25 COMPLEX Lengt 3e-36
3bho_A208 Crystal Structure Of The 25kda Subunit Of Human Cle 3e-36
3p5t_A202 Cfim25-Cfim68 Complex Length = 202 3e-36
3bap_A227 Crystal Structure Of The 25 Kda Subunit Of Human Cl 7e-35
>pdb|2CL3|A Chain A, Crystal Structure Of Human Cleavage And Polyadenylation Specificity Factor 5 (Cpsf5) Length = 230 Back     alignment and structure 
Iteration: 1

 Score =  148 bits (373), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 73/170 (42%), Positives = 106/170 (62%), Gaps = 1/170 (0%)
Query: 20  VVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLL 79
            +++YPL++Y FG+KE +  KD ++  R  RM+  +D  G+R  VE VL+V   + PH+L
Sbjct: 39  TINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVL 98
Query: 80  LLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNXXXXXXXXXXXXCLGMWWKPDFE 139
           LLQ+  + FKLPGG L PGE ++ GLKR +T  L               C+G WW+P+FE
Sbjct: 99  LLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILG-RQDGVLQDWVIDDCIGNWWRPNFE 157
Query: 140 TLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHEN 189
              +PY P ++ +PKE  KLFLV+L     F VPKN KL+A PL ++++N
Sbjct: 158 PPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDN 207
>pdb|2J8Q|A Chain A, Crystal Structure Of Human Cleavage And Polyadenylation Specificity Factor 5 (Cpsf5) In Complex With A Sulphate Ion. Length = 227 Back     alignment and structure
>pdb|3MDG|A Chain A, Crystal Structure Of The 25kda Subunit Of Human Cleavage Factor Im In Complex With Rna Uuguau Length = 227 Back     alignment and structure
>pdb|3Q2S|A Chain A, Crystal Structure Of Cfim68 RrmCFIM25 COMPLEX Length = 207 Back     alignment and structure
>pdb|3BHO|A Chain A, Crystal Structure Of The 25kda Subunit Of Human Cleavage Factor Im With Ap4a Length = 208 Back     alignment and structure
>pdb|3P5T|A Chain A, Cfim25-Cfim68 Complex Length = 202 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query196
3bho_A208 Cleavage and polyadenylation specificity factor su 6e-80
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Length = 208 Back     alignment and structure
 Score =  236 bits (602), Expect = 6e-80
 Identities = 77/172 (44%), Positives = 113/172 (65%), Gaps = 1/172 (0%)

Query: 20  VVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLL 79
            +++YPL++Y FG+KE +  KD ++  R  RM+  +D  G+R  VE VL+V   + PH+L
Sbjct: 17  TINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVL 76

Query: 80  LLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFE 139
           LLQ+  + FKLPGG L PGE ++ GLKR +T  L   +DG   DW + +C+G WW+P+FE
Sbjct: 77  LLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILG-RQDGVLQDWVIDDCIGNWWRPNFE 135

Query: 140 TLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHK 191
              +PY P ++ +PKE  KLFLV+L     F VPKN KL+A PL ++++N  
Sbjct: 136 PPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAP 187

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query196
3bho_A208 Cleavage and polyadenylation specificity factor su 100.0
3i7u_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.39
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 99.29
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.24
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 99.22
3f6a_A159 Hydrolase, nudix family; protein structure initiat 99.19
3f13_A163 Putative nudix hydrolase family member; structural 99.18
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 99.17
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 99.16
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 99.16
3u53_A155 BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; 99.15
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 99.14
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 99.14
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 99.14
3son_A149 Hypothetical nudix hydrolase; structural genomics, 99.13
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 99.11
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 99.11
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 99.11
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 99.1
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 99.08
3grn_A153 MUTT related protein; structural genomics, hydrola 99.06
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 99.05
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 99.05
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 99.04
2fb1_A226 Conserved hypothetical protein; structural genomic 99.04
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 99.04
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 99.04
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 99.04
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 99.04
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 99.03
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 99.03
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 99.02
3gz5_A240 MUTT/nudix family protein; DNA binding protein, nu 99.02
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 99.0
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 99.0
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 99.0
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 99.0
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 98.99
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 98.99
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 98.99
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 98.98
3fcm_A197 Hydrolase, nudix family; protein structure initiat 98.98
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 98.97
3fk9_A188 Mutator MUTT protein; structural genomics, hydrola 98.97
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 98.95
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 98.95
2fml_A273 MUTT/nudix family protein; structural genomics, PS 98.93
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 98.93
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 98.92
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 98.9
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 98.9
3exq_A161 Nudix family hydrolase; protein structure initiati 98.88
2b06_A155 MUTT/nudix family protein; structural genomics, P 98.86
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 98.86
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 98.84
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain 98.79
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 98.79
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 98.78
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 98.77
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 98.74
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 98.71
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 98.7
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 98.69
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydr 98.69
3e57_A211 Uncharacterized protein TM1382; structural genomic 98.68
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 98.68
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 98.68
1q33_A292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix 98.59
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA comp 98.52
3kvh_A214 Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R 98.5
2xsq_A217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp 98.46
3qsj_A232 Nudix hydrolase; structural genomics, PSI-biology, 98.39
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 98.33
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 98.23
2pny_A246 Isopentenyl-diphosphate delta-isomerase 2; caroten 98.15
3rh7_A321 Hypothetical oxidoreductase; FMN-binding split bar 97.8
3dup_A300 MUTT/nudix family protein; nudix superfamily hydro 97.73
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Back     alignment and structure
Probab=100.00  E-value=7.6e-83  Score=540.36  Aligned_cols=186  Identities=41%  Similarity=0.782  Sum_probs=175.3

Q ss_pred             cCcCCCCCCCceEEEeeCCceeeccccCCCCCChhHHHHHHHHHhhhccCCCeeEEEEEEEEecCCCCeEEEEEecCCee
Q 029260            9 VPINGSDRNGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIF   88 (196)
Q Consensus         9 ~~~~~~~~~~~~~~lYPl~nY~Fg~k~~~~ekd~sv~~rl~rl~~~y~~~GmRrsV~aVilvh~~~~phVLLlq~~~~~~   88 (196)
                      ..++++++..++|+||||+||+||+||+++|||+++.+||+||+++|++.|||++|+|||+||+|++|||||+|+++++|
T Consensus         6 ~~~~~~~~~~~~~~iYplsnY~f~~k~~~~ekd~s~~~r~~rl~~~y~~~g~R~sV~avil~~~~~~phVLLlq~~~~~f   85 (208)
T 3bho_A            6 IQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFF   85 (208)
T ss_dssp             CCCCCCTTTCCEEEECBGGGEEEEEECCCCCSCSSHHHHHHHHHHHHHHHCSEEEEEEEEEEEETTEEEEEEEEEETTEE
T ss_pred             ccCCCCccccceEEEecccceeEccCCccccccccHHHHHHHHHHHHHhhCCceEEEEEEEEcCCCCcEEEEEEcCCCcE
Confidence            34567778889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCCcccCCCCChHHHHHHHHHHHhCCCCCCCccceEEeeeeeeeeccCCCcCCCCCCCCCCCCceeeeEEEEEEcCCce
Q 029260           89 KLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQ  168 (196)
Q Consensus        89 ~LPGGrl~~gE~~~e~LkReL~EeLg~~~~~~~~~w~Vge~lg~WwRp~Fet~~yPYlP~Hit~pKE~~klylV~Lpe~~  168 (196)
                      +||||++++||++++||+|||.||||+ ++++..+|+||+|||+|||||||++|||||||||||||||+|||+|||||+|
T Consensus        86 ~LPGGkle~gE~~~eaL~REL~EELg~-~~~~~~~~eIge~lg~wwRp~fet~~YPYlP~Hit~pKE~~kly~V~Lp~~~  164 (208)
T 3bho_A           86 KLPGGELNPGEDEVEGLKRLMTEILGR-QDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKA  164 (208)
T ss_dssp             ECSEEECCTTCCHHHHHHHHHHHHHCC-CC-----CEEEEEEEEEEECSSSSCCBSSCCTTCCSCSEEEEEEEEECCSSE
T ss_pred             ECCCcccCCCCCHHHHHHHHHHHHhCC-CcCCCccEEEhheEEEEecCCCCCcCCCCCCcccCchhhheeeeeEecCccc
Confidence            999999999999999999999999998 4566789999999999999999999999999999999999999999999999


Q ss_pred             EEeeCCCCeEEecccceeecCcccccc
Q 029260          169 KFFVPKNLKLLAVPLCQIHENHKVQFS  195 (196)
Q Consensus       169 ~f~vPkn~kL~AvPLfelydN~~~y~~  195 (196)
                      +|+|||||||+||||||||||+++||.
T Consensus       165 ~f~vPkn~kL~AvPLfely~N~~~yG~  191 (208)
T 3bho_A          165 LFAVPKNYKLVAAPLFELYDNAPGYGP  191 (208)
T ss_dssp             EEEEETTCEEEEEEHHHHTTCHHHHHH
T ss_pred             eEecCCCCeEEeecHHhhhcchhhhch
Confidence            999999999999999999999999984
>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Back     alignment and structure
>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Back     alignment and structure
>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Back     alignment and structure
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Back     alignment and structure
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Back     alignment and structure
>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Back     alignment and structure
>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Back     alignment and structure
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
>3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} Back     alignment and structure
>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Back     alignment and structure
>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Back     alignment and structure
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Back     alignment and structure
>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Back     alignment and structure
>3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query196
d2fvva1135 Diphosphoinositol polyphosphate phosphohydrolase { 99.3
d1vcda1126 AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 99.29
d1nqza_187 Coenzyme A pyrophosphatase {Deinococcus radioduran 99.27
d1k2ea_152 Hypothetical protein PAE3301 {Archaeon Pyrobaculum 99.22
d2azwa1147 Hypothetical protein EF1141 {Enterococcus faecalis 99.18
d2fb1a2147 Hypothetical protein BT0354, N-terminal domain {Ba 99.18
d1puna_129 Nucleoside triphosphate pyrophosphorylase (MutT) { 99.18
d1sjya_158 Hypothetical protein DR1025 {Deinococcus radiodura 99.17
d2b0va1146 Hypothetical protein NE0184 {Nitrosomonas europaea 99.14
d1vk6a2131 NADH pyrophosphatase {Escherichia coli [TaxId: 562 99.14
d2b06a1155 Hypothetical protein SP1235 (spr1115) {Streptococc 99.13
d1ktga_137 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.11
d2a6ta2151 mRNA decapping enzyme Dcp2p catalytic domain {Schi 99.11
d1jkna_165 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.08
d1irya_156 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum 99.06
d1ryaa_160 GDP-mannose mannosyl hydrolase NudD {Escherichia c 99.04
d2fmla2202 Hypothetical protein EF2700, N-terminal domain {En 99.02
d1u20a1196 U8 snorna-binding protein x29 {African clawed frog 98.93
d2fkba1161 Hypothetical protein YfcD {Escherichia coli [TaxId 98.91
d1xsba_153 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 98.81
d2o5fa1162 Hypothetical protein DR0079 {Deinococcus radiodura 98.75
d1vhza_186 ADP compounds hydrolase NudE {Escherichia coli [Ta 98.72
d1hzta_153 Isopentenyl diphosphate isomerase {Escherichia col 98.68
d1v8ya_158 ADP-ribose pyrophosphatase {Thermus thermophilus [ 98.59
d1rrqa2127 Adenine glycosylase MutY, C-terminal domain {Bacil 98.58
d1mqea_202 ADP-ribose pyrophosphatase {Mycobacterium tubercul 98.32
d1q33a_292 NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { 98.21
d1g0sa_209 ADP-ribose pyrophosphatase {Escherichia coli [TaxI 98.1
d1x51a1142 A/G-specific adenine DNA glycosylase {Human (Homo 97.51
d1viua_189 ADP-ribose pyrophosphatase homologue YffH {Escheri 97.4
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: Diphosphoinositol polyphosphate phosphohydrolase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.30  E-value=1.7e-12  Score=97.03  Aligned_cols=77  Identities=17%  Similarity=0.366  Sum_probs=61.6

Q ss_pred             hhhccCCCeeEEEEEEEEecCCCCeEEEEEec--CCeeecCCcccCCCCChHHHHHHHHHHHhCCCCCCCccceEEeeee
Q 029260           53 SNYDAHGLRTCVEAVLLVELFKHPHLLLLQVR--NSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECL  130 (196)
Q Consensus        53 ~~y~~~GmRrsV~aVilvh~~~~phVLLlq~~--~~~~~LPGGrl~~gE~~~e~LkReL~EeLg~~~~~~~~~w~Vge~l  130 (196)
                      +.|+++|.|+.|.+|++.. .+...+||+++.  .+.|.||||++++||++.+|++||+.||+|+       ...+.+.+
T Consensus         3 ~~~~~~~~r~~a~~vv~~~-~~~~~~lL~~~~~~~~~W~~PgG~ve~gEs~~~aa~RE~~EEtGl-------~~~~~~~~   74 (135)
T d2fvva1           3 RTYDGDGYKKRAACLCFRS-ESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGV-------KGTLGRLV   74 (135)
T ss_dssp             CCBCTTSCEEEEEEEEESS-TTCCEEEEEECSSCTTSEECSEEECCTTCCHHHHHHHHHHHHHCE-------EEEEEEEE
T ss_pred             eecCCCCCceEEEEEEEEe-cCCCEEEEEEEeCCCCcEECCccccCCCCCHHHHHHHHHHHHhCC-------cceeeEEE
Confidence            3688999999987777654 444566666654  3789999999999999999999999999999       56777788


Q ss_pred             eeeeccC
Q 029260          131 GMWWKPD  137 (196)
Q Consensus       131 g~WwRp~  137 (196)
                      +.+..+.
T Consensus        75 ~~~~~~~   81 (135)
T d2fvva1          75 GIFENQE   81 (135)
T ss_dssp             EEEEETT
T ss_pred             EEEeecc
Confidence            8775543
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure