Citrus Sinensis ID: 029283


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190------
MAGEDRTLVEILEENNPVDMTKYMTYVSAPQAGAIATFSGTTRDTFDGKIVVELRYESYVSMAIRCIKSICSLARSSWNLHSIAVAHRLGPVPVGETSVFIAVSAVHRADALDACKFLIDELKASVPIWKKEVYSNGEVWKENSEFMERRLDLGKKDGICCGSGREVPVKSHARKTCCGAKVKVDDEGLANINSSK
cccccccEEEEEEECccccHHHHHHHcccccccEEEEEEEEECcccccccEEEEEEcccHHHHHHHHHHHHHHHHHHccccEEEEEEECcccccccEEEEEEEccccHHHHHHHHHHHHHHHcccccccccCECccccccccccHHHHHHHHcccccccccccccccccccccccccccccEEEcccccccccccc
******T***ILEENNPVDMTKYMTYVSAPQAGAIATFSGTTRDTFDGKIVVELRYESYVSMAIRCIKSICSLARSSWNLHSIAVAHRLGPVPVGETSVFIAVSAVHRADALDACKFLIDELKASVPIWKKEVYSNGEVWKENSEFMERRLDLGKKDGICCGSGREVPVKSHARKTCCGAKVKV************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGEDRTLVEILEENNPVDMTKYMTYVSAPQAGAIATFSGTTRDTFDGKIVVELRYESYVSMAIRCIKSICSLARSSWNLHSIAVAHRLGPVPVGETSVFIAVSAVHRADALDACKFLIDELKASVPIWKKEVYSNGEVWKENSEFMERRLDLGKKDGICCGSGREVPVKSHARKTCCGAKVKVDDEGLANINSSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Molybdopterin synthase catalytic subunit Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group.probableQ6Z2X3
Molybdopterin synthase catalytic subunit Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group.probableO22827
Molybdopterin synthase catalytic subunit Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group.probableQ7QAD7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FM0, chain E
Confidence level:very confident
Coverage over the Query: 10-150
View the alignment between query and template
View the model in PyMOL