Citrus Sinensis ID: 029287

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190------
MQVKGGKGPFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKEGKIVPSEVTVSLIQKEMESSDSKKFLIDGFPRSEENRAAFERIMGAEPDIVLFFDCPEEEMVNRVLNRNEGRVDDNIDTVRKRLQVFKALNLPVINYYARRGKLYTINAVGTVDEIFEQVRAVFAALKLVTE
cccccccccEEEEEEccccccHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHccccccccccHHHHHHHHHHHHHcHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHcccccc
********PFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKEGKIVPSEVTVSLIQKEMESSDSKKFLIDGFPRSEENRAAFERIMGAEPDIVLFFDCPEEEMVNRVLNRNEGRVDDNIDTVRKRLQVFKALNLPVINYYARRGKLYTINAVGTVDEIFEQVRAVFAALKLV**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQVKGGKGPFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKEGKIVPSEVTVSLIQKEMESSDSKKFLIDGFPRSEENRAAFERIMGAEPDIVLFFDCPEEEMVNRVLNRNEGRVDDNIDTVRKRLQVFKALNLPVINYYARRGKLYTINAVGTVDEIFEQVRAVFAALKLVTE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adenylate kinase Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. This small ubiquitous enzyme involved in the energy metabolism and nucleotide synthesis, is essential for maintenance and cell growth.probableQ89ZJ0
Adenylate kinase Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. This small ubiquitous enzyme involved in the energy metabolism and nucleotide synthesis, is essential for maintenance and cell growth.probableQ5LGH0
Adenylate kinase Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. This small ubiquitous enzyme involved in the energy metabolism and nucleotide synthesis, is essential for maintenance and cell growth.probableQ3AW74

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.4.-2,7,4'-trihydroxyisoflavanone 4'-O-methyltransferase.probable
2.7.4.14Transferred entry: 2.7.4.14.probable
2.7.4.3Adenylate kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UMF, chain A
Confidence level:very confident
Coverage over the Query: 4-192
View the alignment between query and template
View the model in PyMOL