Citrus Sinensis ID: 029287


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190------
MQVKGGKGPFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKEGKIVPSEVTVSLIQKEMESSDSKKFLIDGFPRSEENRAAFERIMGAEPDIVLFFDCPEEEMVNRVLNRNEGRVDDNIDTVRKRLQVFKALNLPVINYYARRGKLYTINAVGTVDEIFEQVRAVFAALKLVTE
cccccccccEEEEEEccccccHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHcccccc
cccccccccEEEEEEEcccccHHHHHHHHHHHHccEEEEHHHHHHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHccccccccccHHHHHHHHHHHcHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHccccccc
mqvkggkgpficfvlggpgsgkgtqCAKIVKNyglthlsaGELLRREIASNSEYGTTILNtikegkivpsEVTVSLIQKEmessdskkflidgfprseeNRAAFERImgaepdivlffdcpeEEMVNRVLnrnegrvddniDTVRKRLQVFKALNLPVINYYARrgklytinavgTVDEIFEQVRAVFAALKLVTE
mqvkggkgpfICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTilntikegkivpSEVTVSLIQkemessdskkflidgfpRSEENRAAFERIMGAEPDIVLFFDCPEEEMVNRVlnrnegrvddnidtVRKRLQvfkalnlpvinyyARRGKLYTINAVGTVDEIFEQVRAVFAALKLVTE
MQVKGGKGPFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKEGKIVPSEVTVSLIQKEMESSDSKKFLIDGFPRSEENRAAFERIMGAEPDIVLFFDCPEEEMVNRVLNRNEGRVDDNIDTVRKRLQVFKALNLPVINYYARRGKLYTINAVGTVDEIFEQVRAVFAALKLVTE
********PFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKEGKIVPSEVTVSLI************************AAFERIMGAEPDIVLFFDCPEEEMVNRVLNRNEGRVDDNIDTVRKRLQVFKALNLPVINYYARRGKLYTINAVGTVDEIFEQVRAVFAALKLV**
************FVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIA*****GTTILNTIKEGKIVPSEVTVSLIQKEMESSDSKKFLIDGFPRSEENRAAFERIMGAEPDIVLFFDCPEEEMVNRVLNRNEGRVDDNIDTVRKRLQVFKALNLPVINYYARRGKLYTINAVGTVDEIFEQVRAVFAALKLV**
MQVKGGKGPFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKEGKIVPSEVTVSLIQKEMESSDSKKFLIDGFPRSEENRAAFERIMGAEPDIVLFFDCPEEEMVNRVLNRNEGRVDDNIDTVRKRLQVFKALNLPVINYYARRGKLYTINAVGTVDEIFEQVRAVFAALKLVTE
*****GKGPFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKEGKIVPSEVTVSLIQKEMESSDSKKFLIDGFPRSEENRAAFERIMGAEPDIVLFFDCPEEEMVNRVLNRNEGRVDDNIDTVRKRLQVFKALNLPVINYYARRGKLYTINAVGTVDEIFEQVRAVFAALK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQVKGGKGPFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKEGKIVPSEVTVSLIQKEMESSDSKKFLIDGFPRSEENRAAFERIMGAEPDIVLFFDCPEEEMVNRVLNRNEGRVDDNIDTVRKRLQVFKALNLPVINYYARRGKLYTINAVGTVDEIFEQVRAVFAALKLVTE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query196 2.2.26 [Sep-21-2011]
O24464231 Adenylate kinase OS=Prunu N/A no 0.933 0.792 0.775 4e-84
O04905202 UMP/CMP kinase OS=Arabido no no 0.938 0.910 0.635 2e-65
Q7ZX23193 UMP-CMP kinase OS=Xenopus N/A no 0.918 0.932 0.478 3e-46
Q28H12196 UMP-CMP kinase OS=Xenopus no no 0.918 0.918 0.473 7e-46
P30085196 UMP-CMP kinase OS=Homo sa yes no 0.918 0.918 0.478 9e-45
Q4KM73196 UMP-CMP kinase OS=Rattus yes no 0.918 0.918 0.478 2e-44
Q5ZKE7196 UMP-CMP kinase OS=Gallus yes no 0.918 0.918 0.478 4e-44
Q9DBP5196 UMP-CMP kinase OS=Mus mus yes no 0.918 0.918 0.478 4e-44
Q2KIW9196 UMP-CMP kinase OS=Bos tau yes no 0.918 0.918 0.473 7e-44
Q29561196 UMP-CMP kinase OS=Sus scr yes no 0.918 0.918 0.473 8e-44
>sp|O24464|KAD_PRUAR Adenylate kinase OS=Prunus armeniaca PE=2 SV=1 Back     alignment and function desciption
 Score =  310 bits (794), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 142/183 (77%), Positives = 166/183 (90%)

Query: 9   PFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKEGKIV 68
           PF+ FVLGGPGSGKGTQCAKIV+ +G TH+SAG+LLRREIAS S YG+ IL+TI+EGKIV
Sbjct: 47  PFVTFVLGGPGSGKGTQCAKIVEAFGFTHVSAGDLLRREIASGSAYGSVILSTIREGKIV 106

Query: 69  PSEVTVSLIQKEMESSDSKKFLIDGFPRSEENRAAFERIMGAEPDIVLFFDCPEEEMVNR 128
           PS+VTV LIQKEMESSD+ KFLIDGFPRSEENR AFE+ +GAEPD+VLFFDCPE+EMV R
Sbjct: 107 PSQVTVELIQKEMESSDNYKFLIDGFPRSEENRKAFEQTIGAEPDVVLFFDCPEQEMVKR 166

Query: 129 VLNRNEGRVDDNIDTVRKRLQVFKALNLPVINYYARRGKLYTINAVGTVDEIFEQVRAVF 188
           VLNRN+GRVDDNIDT++KRL++F  LN PVINYY++RGKL+ INAVGTVDEIFE+VR +F
Sbjct: 167 VLNRNQGRVDDNIDTIKKRLEIFDELNWPVINYYSQRGKLHKINAVGTVDEIFEKVRPIF 226

Query: 189 AAL 191
           A L
Sbjct: 227 APL 229




This small ubiquitous enzyme is essential for maintenance and cell growth.
Prunus armeniaca (taxid: 36596)
EC: 2EC: .EC: 7EC: .EC: 4EC: .EC: 3
>sp|O04905|UMPK_ARATH UMP/CMP kinase OS=Arabidopsis thaliana GN=PYR6 PE=1 SV=1 Back     alignment and function description
>sp|Q7ZX23|KCY_XENLA UMP-CMP kinase OS=Xenopus laevis GN=cmpk1 PE=2 SV=2 Back     alignment and function description
>sp|Q28H12|KCY_XENTR UMP-CMP kinase OS=Xenopus tropicalis GN=cmpk1 PE=2 SV=2 Back     alignment and function description
>sp|P30085|KCY_HUMAN UMP-CMP kinase OS=Homo sapiens GN=CMPK1 PE=1 SV=3 Back     alignment and function description
>sp|Q4KM73|KCY_RAT UMP-CMP kinase OS=Rattus norvegicus GN=Cmpk1 PE=1 SV=2 Back     alignment and function description
>sp|Q5ZKE7|KCY_CHICK UMP-CMP kinase OS=Gallus gallus GN=CMPK1 PE=2 SV=1 Back     alignment and function description
>sp|Q9DBP5|KCY_MOUSE UMP-CMP kinase OS=Mus musculus GN=Cmpk1 PE=1 SV=1 Back     alignment and function description
>sp|Q2KIW9|KCY_BOVIN UMP-CMP kinase OS=Bos taurus GN=CMPK1 PE=2 SV=2 Back     alignment and function description
>sp|Q29561|KCY_PIG UMP-CMP kinase OS=Sus scrofa GN=CMPK1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query196
255539731 298 uridylate kinase plant, putative [Ricinu 0.948 0.624 0.790 2e-82
3913952231 RecName: Full=Adenylate kinase; Short=AK 0.933 0.792 0.775 2e-82
449460858271 PREDICTED: adenylate kinase-like [Cucumi 0.954 0.690 0.780 1e-81
225466049238 PREDICTED: adenylate kinase [Vitis vinif 0.933 0.768 0.770 2e-80
224136762235 predicted protein [Populus trichocarpa] 0.969 0.808 0.742 3e-80
356544256236 PREDICTED: adenylate kinase-like [Glycin 0.928 0.771 0.758 7e-79
297799466 758 hypothetical protein ARALYDRAFT_354257 [ 0.969 0.250 0.721 3e-78
30686829249 adenylate kinase family protein [Arabido 0.969 0.763 0.721 5e-78
356531704231 PREDICTED: adenylate kinase-like [Glycin 0.928 0.787 0.752 6e-78
357490447218 Adenylate kinase [Medicago truncatula] g 0.918 0.825 0.733 5e-75
>gi|255539731|ref|XP_002510930.1| uridylate kinase plant, putative [Ricinus communis] gi|223550045|gb|EEF51532.1| uridylate kinase plant, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 165/186 (88%)

Query: 5   GGKGPFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKE 64
           G K PF+ FVLGGPGSGKGTQC KI K +G  HLSAG+LLRREI SNS+ G  ILNTIKE
Sbjct: 108 GEKTPFMTFVLGGPGSGKGTQCLKIAKTFGFKHLSAGDLLRREILSNSDDGAMILNTIKE 167

Query: 65  GKIVPSEVTVSLIQKEMESSDSKKFLIDGFPRSEENRAAFERIMGAEPDIVLFFDCPEEE 124
           G+IVPSEVTV LI+KEME SD+ KFLIDGFPR+EENR AFE I+GAEP+IVLFFDCP+EE
Sbjct: 168 GRIVPSEVTVKLIKKEMELSDNSKFLIDGFPRTEENRIAFEHIIGAEPNIVLFFDCPQEE 227

Query: 125 MVNRVLNRNEGRVDDNIDTVRKRLQVFKALNLPVINYYARRGKLYTINAVGTVDEIFEQV 184
           MV RVLNRNEGRVDDNIDT++KRL+VF ALNLPVI YY+++GKL+TINAVGTVDEIFEQV
Sbjct: 228 MVKRVLNRNEGRVDDNIDTIKKRLEVFSALNLPVIGYYSKKGKLHTINAVGTVDEIFEQV 287

Query: 185 RAVFAA 190
           R VFAA
Sbjct: 288 RPVFAA 293




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|3913952|sp|O24464.1|KAD_PRUAR RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP transphosphorylase gi|2351578|gb|AAB68604.1| adenylate kinase homolog [Prunus armeniaca] Back     alignment and taxonomy information
>gi|449460858|ref|XP_004148161.1| PREDICTED: adenylate kinase-like [Cucumis sativus] gi|449499691|ref|XP_004160888.1| PREDICTED: adenylate kinase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225466049|ref|XP_002263160.1| PREDICTED: adenylate kinase [Vitis vinifera] gi|296084179|emb|CBI24567.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224136762|ref|XP_002322409.1| predicted protein [Populus trichocarpa] gi|222869405|gb|EEF06536.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356544256|ref|XP_003540570.1| PREDICTED: adenylate kinase-like [Glycine max] Back     alignment and taxonomy information
>gi|297799466|ref|XP_002867617.1| hypothetical protein ARALYDRAFT_354257 [Arabidopsis lyrata subsp. lyrata] gi|297313453|gb|EFH43876.1| hypothetical protein ARALYDRAFT_354257 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30686829|ref|NP_194258.2| adenylate kinase family protein [Arabidopsis thaliana] gi|38603926|gb|AAR24708.1| At4g25280 [Arabidopsis thaliana] gi|44681436|gb|AAS47658.1| At4g25280 [Arabidopsis thaliana] gi|332659634|gb|AEE85034.1| adenylate kinase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356531704|ref|XP_003534416.1| PREDICTED: adenylate kinase-like [Glycine max] Back     alignment and taxonomy information
>gi|357490447|ref|XP_003615511.1| Adenylate kinase [Medicago truncatula] gi|355516846|gb|AES98469.1| Adenylate kinase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query196
TAIR|locus:2122644249 AT4G25280 [Arabidopsis thalian 0.969 0.763 0.721 4.1e-72
TAIR|locus:1005716878208 PYR6 [Arabidopsis thaliana (ta 0.938 0.884 0.635 1.2e-60
TAIR|locus:2101472204 AT3G60180 [Arabidopsis thalian 0.918 0.882 0.588 2.9e-55
UNIPROTKB|P30085196 CMPK1 "UMP-CMP kinase" [Homo s 0.918 0.918 0.478 4e-42
UNIPROTKB|Q5ZKE7196 CMPK1 "UMP-CMP kinase" [Gallus 0.918 0.918 0.478 8.4e-42
RGD|1310116196 Cmpk1 "cytidine monophosphate 0.918 0.918 0.478 8.4e-42
MGI|MGI:1913838196 Cmpk1 "cytidine monophosphate 0.918 0.918 0.478 1.1e-41
UNIPROTKB|Q2KIW9196 CMPK1 "UMP-CMP kinase" [Bos ta 0.918 0.918 0.473 1.7e-41
UNIPROTKB|F1PIG2228 CMPK1 "Uncharacterized protein 0.918 0.789 0.473 1.7e-41
UNIPROTKB|Q29561196 CMPK1 "UMP-CMP kinase" [Sus sc 0.918 0.918 0.473 1.7e-41
TAIR|locus:2122644 AT4G25280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 729 (261.7 bits), Expect = 4.1e-72, P = 4.1e-72
 Identities = 137/190 (72%), Positives = 164/190 (86%)

Query:     7 KGPFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKEGK 66
             K PFI FVLGGPGSGKGTQC KIV+ +GL HLSAG+LLRREIA ++E G  ILN IK+GK
Sbjct:    41 KAPFITFVLGGPGSGKGTQCEKIVETFGLQHLSAGDLLRREIAMHTENGAMILNLIKDGK 100

Query:    67 IVPSEVTVSLIQKEMESSDSKKFLIDGFPRSEENRAAFERIMGAEPDIVLFFDCPEEEMV 126
             IVPSEVTV LIQKE+ESSD++KFLIDGFPR+EENR AFERI+ A+PD+VLFFDCPEEEMV
Sbjct:   101 IVPSEVTVKLIQKELESSDNRKFLIDGFPRTEENRVAFERIIRADPDVVLFFDCPEEEMV 160

Query:   127 NRVLNRNEGRVDDNIDTVRKRLQVFKALNLPVINYYARRGKLYTINAVGTVDEIFEQVRA 186
              RVLNRN+GR+DDNI T++KRL++F ALN PVI+YY  +GKLYTINAVGTVD+IF+ V  
Sbjct:   161 KRVLNRNQGRIDDNITTMKKRLKIFNALNRPVIDYYKNKGKLYTINAVGTVDDIFQHVLP 220

Query:   187 VFAALKLVTE 196
             +F + + + E
Sbjct:   221 IFNSFEQLKE 230




GO:0005524 "ATP binding" evidence=IEA
GO:0006139 "nucleobase-containing compound metabolic process" evidence=IEA
GO:0016776 "phosphotransferase activity, phosphate group as acceptor" evidence=IEA
GO:0019201 "nucleotide kinase activity" evidence=IEA;ISS
GO:0019205 "nucleobase-containing compound kinase activity" evidence=IEA
GO:0046939 "nucleotide phosphorylation" evidence=IEA
GO:0006354 "DNA-dependent transcription, elongation" evidence=RCA
TAIR|locus:1005716878 PYR6 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101472 AT3G60180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P30085 CMPK1 "UMP-CMP kinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKE7 CMPK1 "UMP-CMP kinase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1310116 Cmpk1 "cytidine monophosphate (UMP-CMP) kinase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1913838 Cmpk1 "cytidine monophosphate (UMP-CMP) kinase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIW9 CMPK1 "UMP-CMP kinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PIG2 CMPK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q29561 CMPK1 "UMP-CMP kinase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q89ZJ0KAD_BACTN2, ., 7, ., 4, ., 30.36720.87240.9047yesno
B0RP52KAD_XANCB2, ., 7, ., 4, ., 30.35750.88260.9251yesno
Q5ZKE7KCY_CHICK2, ., 7, ., 4, ., 1, 40.47890.91830.9183yesno
B1MGB3KAD_MYCA92, ., 7, ., 4, ., 30.40220.84690.9171yesno
B4SI37KAD_STRM52, ., 7, ., 4, ., 30.34420.90300.9465yesno
Q2KIW9KCY_BOVIN2, ., 7, ., 4, ., 1, 40.47360.91830.9183yesno
Q8P5P5KAD_XANCP2, ., 7, ., 4, ., 30.36310.88260.9251yesno
C1CXE5KAD_DEIDV2, ., 7, ., 4, ., 30.32970.88770.8832yesno
Q8PH23KAD_XANAC2, ., 7, ., 4, ., 30.36310.88260.9251yesno
P15700UMPK_YEAST2, ., 7, ., 4, ., -0.45300.88770.8529yesno
Q64XA6KAD_BACFR2, ., 7, ., 4, ., 30.38980.87240.9047yesno
Q4KM73KCY_RAT2, ., 7, ., 4, ., 1, 40.47890.91830.9183yesno
A5GIS6KAD_SYNPW2, ., 7, ., 4, ., 30.32770.89280.9562yesno
Q7MW54KAD_PORGI2, ., 7, ., 4, ., 30.38850.86220.8711yesno
Q5LGH0KAD_BACFN2, ., 7, ., 4, ., 30.38980.87240.9047yesno
Q2P743KAD_XANOM2, ., 7, ., 4, ., 30.35910.89280.9358yesno
B2RIY8KAD_PORG32, ., 7, ., 4, ., 30.38850.86220.8711yesno
Q9DBP5KCY_MOUSE2, ., 7, ., 4, ., 1, 40.47890.91830.9183yesno
Q9RSK7KAD_DEIRA2, ., 7, ., 4, ., 30.33510.88770.8832yesno
A6L0Z9KAD_BACV82, ., 7, ., 4, ., 30.36950.90810.9417yesno
Q29561KCY_PIG2, ., 7, ., 4, ., 1, 40.47360.91830.9183yesno
P30085KCY_HUMAN2, ., 7, ., 4, ., 1, 40.47890.91830.9183yesno
Q7ZWE9KCY_DANRE2, ., 7, ., 4, ., 1, 40.47360.91830.9183yesno
Q20140KAD1_CAEEL2, ., 7, ., 4, ., 30.49170.89280.8333yesno
P20425KCY_DICDI2, ., 7, ., 4, ., 1, 40.47590.93360.9384yesno
C0R000KAD_BRAHW2, ., 7, ., 4, ., 30.33510.90810.9621yesno
O24464KAD_PRUAR2, ., 7, ., 4, ., 30.77590.93360.7922N/Ano
A5GVX9KAD_SYNR32, ., 7, ., 4, ., 30.35710.89280.9615yesno
O59771UMPK_SCHPO2, ., 7, ., 4, ., -0.40780.87240.8952yesno
A6LD69KAD_PARD82, ., 7, ., 4, ., 30.35290.92340.9526yesno
Q3BPM9KAD_XANC52, ., 7, ., 4, ., 30.36310.88260.9251yesno
Q4UYC6KAD_XANC82, ., 7, ., 4, ., 30.36310.88260.9251yesno
Q3AW74KAD_SYNS92, ., 7, ., 4, ., 30.35190.88770.9508yesno
Q5H4A4KAD_XANOR2, ., 7, ., 4, ., 30.35910.89280.9358yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.40.976
4th Layer2.7.4.140.914
3rd Layer2.7.4.30.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.XV.2929.1
adenylate kinase family protein (EC-2.7.4.14) (224 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pm.C_LG_V000114
ribonucleoside-diphosphate reductase (EC-1.17.4.1); Provides the precursors necessary for DNA s [...] (817 aa)
       0.901
eugene3.00051017
ribonucleoside-diphosphate reductase (EC-1.17.4.1); Provides the precursors necessary for DNA s [...] (810 aa)
       0.901
estExt_fgenesh4_pg.C_LG_VII0648
ribonucleoside-diphosphate reductase (EC-1.17.4.1); Provides the precursors necessary for DNA s [...] (813 aa)
       0.901
fgenesh4_pg.C_LG_I002334
ribonucleoside-diphosphate reductase (EC-1.17.4.1) (329 aa)
       0.900
estExt_Genewise1_v1.C_880196
ribonucleoside-diphosphate reductase (EC-1.17.4.1) (329 aa)
       0.900
gw1.VIII.327.1
ribonucleoside-diphosphate reductase (EC-1.17.4.1) (342 aa)
       0.900
gw1.XVII.653.1
hypothetical protein (417 aa)
       0.899
gw1.XIII.2192.1
polyribonucleotide nucleotidyltransferase (EC-2.7.7.8) (853 aa)
       0.899
gw1.II.1445.1
SubName- Full=Putative uncharacterized protein; (164 aa)
       0.899
gw1.I.2477.1
hypothetical protein (950 aa)
       0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query196
PLN02200234 PLN02200, PLN02200, adenylate kinase family protei 1e-123
TIGR01359183 TIGR01359, UMP_CMP_kin_fam, UMP-CMP kinase family 6e-98
cd01428194 cd01428, ADK, Adenylate kinase (ADK) catalyzes the 4e-66
TIGR01360188 TIGR01360, aden_kin_iso1, adenylate kinase, isozym 2e-65
pfam00406186 pfam00406, ADK, Adenylate kinase 9e-58
PRK00279215 PRK00279, adk, adenylate kinase; Reviewed 8e-55
TIGR01351210 TIGR01351, adk, adenylate kinase 2e-53
COG0563178 COG0563, Adk, Adenylate kinase and related kinases 9e-47
PRK14527191 PRK14527, PRK14527, adenylate kinase; Provisional 4e-45
PRK02496184 PRK02496, adk, adenylate kinase; Provisional 1e-39
PRK14531183 PRK14531, PRK14531, adenylate kinase; Provisional 3e-37
PRK14528186 PRK14528, PRK14528, adenylate kinase; Provisional 4e-33
PRK14532188 PRK14532, PRK14532, adenylate kinase; Provisional 1e-31
PRK14530215 PRK14530, PRK14530, adenylate kinase; Provisional 1e-29
PRK13808 333 PRK13808, PRK13808, adenylate kinase; Provisional 4e-29
PLN02842 505 PLN02842, PLN02842, nucleotide kinase 7e-27
PLN02459261 PLN02459, PLN02459, probable adenylate kinase 2e-23
PLN02674244 PLN02674, PLN02674, adenylate kinase 9e-22
PRK14526211 PRK14526, PRK14526, adenylate kinase; Provisional 9e-19
PRK14529223 PRK14529, PRK14529, adenylate kinase; Provisional 5e-17
PTZ00088229 PTZ00088, PTZ00088, adenylate kinase 1; Provisiona 4e-15
pfam13207114 pfam13207, AAA_17, AAA domain 3e-06
PRK04182180 PRK04182, PRK04182, cytidylate kinase; Provisional 3e-05
TIGR02173171 TIGR02173, cyt_kin_arch, cytidylate kinase, putati 7e-04
COG0125208 COG0125, Tmk, Thymidylate kinase [Nucleotide trans 7e-04
COG1102179 COG1102, Cmk, Cytidylate kinase [Nucleotide transp 8e-04
>gnl|CDD|215125 PLN02200, PLN02200, adenylate kinase family protein Back     alignment and domain information
 Score =  347 bits (891), Expect = e-123
 Identities = 153/192 (79%), Positives = 173/192 (90%)

Query: 5   GGKGPFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKE 64
             K PFI FVLGGPGSGKGTQC KIV+ +G  HLSAG+LLRREIASNSE+G  ILNTIKE
Sbjct: 39  KEKTPFITFVLGGPGSGKGTQCEKIVETFGFKHLSAGDLLRREIASNSEHGAMILNTIKE 98

Query: 65  GKIVPSEVTVSLIQKEMESSDSKKFLIDGFPRSEENRAAFERIMGAEPDIVLFFDCPEEE 124
           GKIVPSEVTV LIQKEMESSD+ KFLIDGFPR+EENR AFERI+GAEP++VLFFDCPEEE
Sbjct: 99  GKIVPSEVTVKLIQKEMESSDNNKFLIDGFPRTEENRIAFERIIGAEPNVVLFFDCPEEE 158

Query: 125 MVNRVLNRNEGRVDDNIDTVRKRLQVFKALNLPVINYYARRGKLYTINAVGTVDEIFEQV 184
           MV RVLNRN+GRVDDNIDT++KRL+VF ALNLPVI+YY+++GKLYTINAVGTVDEIFEQV
Sbjct: 159 MVKRVLNRNQGRVDDNIDTIKKRLKVFNALNLPVIDYYSKKGKLYTINAVGTVDEIFEQV 218

Query: 185 RAVFAALKLVTE 196
           R +FAA + + E
Sbjct: 219 RPIFAACEAMKE 230


Length = 234

>gnl|CDD|130426 TIGR01359, UMP_CMP_kin_fam, UMP-CMP kinase family Back     alignment and domain information
>gnl|CDD|238713 cd01428, ADK, Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>gnl|CDD|130427 TIGR01360, aden_kin_iso1, adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>gnl|CDD|201213 pfam00406, ADK, Adenylate kinase Back     alignment and domain information
>gnl|CDD|234711 PRK00279, adk, adenylate kinase; Reviewed Back     alignment and domain information
>gnl|CDD|233369 TIGR01351, adk, adenylate kinase Back     alignment and domain information
>gnl|CDD|223637 COG0563, Adk, Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|237745 PRK14527, PRK14527, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|179433 PRK02496, adk, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|172997 PRK14531, PRK14531, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|172994 PRK14528, PRK14528, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184729 PRK14532, PRK14532, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|237747 PRK14530, PRK14530, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|178435 PLN02842, PLN02842, nucleotide kinase Back     alignment and domain information
>gnl|CDD|215253 PLN02459, PLN02459, probable adenylate kinase Back     alignment and domain information
>gnl|CDD|178279 PLN02674, PLN02674, adenylate kinase Back     alignment and domain information
>gnl|CDD|172992 PRK14526, PRK14526, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|237746 PRK14529, PRK14529, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|240262 PTZ00088, PTZ00088, adenylate kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information
>gnl|CDD|235244 PRK04182, PRK04182, cytidylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|233761 TIGR02173, cyt_kin_arch, cytidylate kinase, putative Back     alignment and domain information
>gnl|CDD|223203 COG0125, Tmk, Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|224027 COG1102, Cmk, Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 196
KOG3079195 consensus Uridylate kinase/adenylate kinase [Nucle 100.0
PLN02200234 adenylate kinase family protein 100.0
PLN02674244 adenylate kinase 100.0
PRK14531183 adenylate kinase; Provisional 100.0
PRK13808 333 adenylate kinase; Provisional 100.0
PLN02459261 probable adenylate kinase 100.0
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 100.0
PRK14528186 adenylate kinase; Provisional 100.0
PRK14529223 adenylate kinase; Provisional 100.0
PRK14532188 adenylate kinase; Provisional 100.0
PRK14527191 adenylate kinase; Provisional 100.0
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 100.0
PRK02496184 adk adenylate kinase; Provisional 100.0
PRK14526211 adenylate kinase; Provisional 100.0
PRK00279215 adk adenylate kinase; Reviewed 99.98
PTZ00088229 adenylate kinase 1; Provisional 99.97
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 99.97
PRK14530215 adenylate kinase; Provisional 99.97
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 99.96
PLN02842 505 nucleotide kinase 99.96
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 99.96
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 99.96
KOG3078235 consensus Adenylate kinase [Nucleotide transport a 99.9
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 99.87
PRK13973213 thymidylate kinase; Provisional 99.87
PRK01184184 hypothetical protein; Provisional 99.86
PRK13974212 thymidylate kinase; Provisional 99.86
PLN02924220 thymidylate kinase 99.85
PRK00698205 tmk thymidylate kinase; Validated 99.81
PRK13975196 thymidylate kinase; Provisional 99.81
PRK00081194 coaE dephospho-CoA kinase; Reviewed 99.81
PRK07933213 thymidylate kinase; Validated 99.8
PRK03839180 putative kinase; Provisional 99.79
PRK08356195 hypothetical protein; Provisional 99.79
PRK13976209 thymidylate kinase; Provisional 99.79
PRK06217183 hypothetical protein; Validated 99.78
PRK14730195 coaE dephospho-CoA kinase; Provisional 99.78
PRK14734200 coaE dephospho-CoA kinase; Provisional 99.78
PRK14731208 coaE dephospho-CoA kinase; Provisional 99.78
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 99.77
PRK08233182 hypothetical protein; Provisional 99.77
PLN02422232 dephospho-CoA kinase 99.77
PRK14733204 coaE dephospho-CoA kinase; Provisional 99.76
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 99.76
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 99.75
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 99.75
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 99.75
PTZ00451244 dephospho-CoA kinase; Provisional 99.74
PRK14732196 coaE dephospho-CoA kinase; Provisional 99.73
PRK04040188 adenylate kinase; Provisional 99.73
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 99.73
PRK13949169 shikimate kinase; Provisional 99.73
COG0703172 AroK Shikimate kinase [Amino acid transport and me 99.71
PRK08118167 topology modulation protein; Reviewed 99.71
COG1936180 Predicted nucleotide kinase (related to CMP and AM 99.7
PRK03731171 aroL shikimate kinase II; Reviewed 99.7
PHA02530 300 pseT polynucleotide kinase; Provisional 99.68
PRK06762166 hypothetical protein; Provisional 99.68
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 99.67
PRK04182180 cytidylate kinase; Provisional 99.67
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 99.67
PRK03333 395 coaE dephospho-CoA kinase/protein folding accessor 99.66
KOG3327208 consensus Thymidylate kinase/adenylate kinase [Nuc 99.66
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 99.66
TIGR00152188 dephospho-CoA kinase. This model produces scores i 99.66
KOG3220225 consensus Similar to bacterial dephospho-CoA kinas 99.66
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 99.65
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 99.65
PRK13946184 shikimate kinase; Provisional 99.64
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 99.64
PRK00131175 aroK shikimate kinase; Reviewed 99.64
PRK13947171 shikimate kinase; Provisional 99.62
PRK00625173 shikimate kinase; Provisional 99.62
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 99.62
PRK13948182 shikimate kinase; Provisional 99.62
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 99.62
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 99.6
PRK05057172 aroK shikimate kinase I; Reviewed 99.6
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 99.6
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 99.59
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 99.59
PRK05480209 uridine/cytidine kinase; Provisional 99.59
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 99.58
PRK09825176 idnK D-gluconate kinase; Provisional 99.57
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 99.57
PRK11545163 gntK gluconate kinase 1; Provisional 99.56
PRK14738206 gmk guanylate kinase; Provisional 99.55
PLN02199303 shikimate kinase 99.55
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 99.54
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 99.54
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 99.54
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 99.54
PRK08154309 anaerobic benzoate catabolism transcriptional regu 99.54
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 99.52
PRK14021 542 bifunctional shikimate kinase/3-dehydroquinate syn 99.51
PRK07261171 topology modulation protein; Provisional 99.51
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.5
PRK05541176 adenylylsulfate kinase; Provisional 99.5
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 99.48
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 99.48
PRK12339197 2-phosphoglycerate kinase; Provisional 99.47
PTZ00301210 uridine kinase; Provisional 99.47
PRK00023225 cmk cytidylate kinase; Provisional 99.47
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.47
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.47
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 99.47
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.47
PRK06547172 hypothetical protein; Provisional 99.46
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 99.46
TIGR00235207 udk uridine kinase. Model contains a number of lon 99.45
COG4088261 Predicted nucleotide kinase [Nucleotide transport 99.45
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 99.45
COG1127263 Ttg2A ABC-type transport system involved in resist 99.45
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 99.44
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 99.44
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 99.43
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.41
PRK06696223 uridine kinase; Validated 99.39
PRK14737186 gmk guanylate kinase; Provisional 99.39
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.38
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.38
KOG4235244 consensus Mitochondrial thymidine kinase 2/deoxygu 99.38
PRK12338 319 hypothetical protein; Provisional 99.37
PRK03846198 adenylylsulfate kinase; Provisional 99.37
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 99.37
PHA03132580 thymidine kinase; Provisional 99.36
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 99.36
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.35
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.34
KOG3877393 consensus NADH:ubiquinone oxidoreductase, NDUFA10/ 99.34
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 99.33
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate syn 99.33
PRK07429 327 phosphoribulokinase; Provisional 99.33
PRK00300205 gmk guanylate kinase; Provisional 99.32
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 99.32
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.31
PRK07667193 uridine kinase; Provisional 99.31
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.31
PLN02348 395 phosphoribulokinase 99.3
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 99.29
PRK11860661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 99.29
COG4148 352 ModC ABC-type molybdate transport system, ATPase c 99.29
COG1123539 ATPase components of various ABC-type transport sy 99.29
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.28
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 99.27
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 99.27
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 99.26
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.26
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 99.25
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 99.25
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 99.25
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 99.24
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 99.23
PRK00889175 adenylylsulfate kinase; Provisional 99.22
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.22
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 99.21
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.2
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 99.19
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.19
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 99.19
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 99.18
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.18
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.17
PRK05416 288 glmZ(sRNA)-inactivating NTPase; Provisional 99.17
PRK13537306 nodulation ABC transporter NodI; Provisional 99.17
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 99.16
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 99.16
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 99.16
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 99.15
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 99.15
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.15
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 99.15
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.15
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.15
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.14
COG0411250 LivG ABC-type branched-chain amino acid transport 99.14
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 99.14
COG0410237 LivF ABC-type branched-chain amino acid transport 99.14
PRK09270229 nucleoside triphosphate hydrolase domain-containin 99.13
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 99.13
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.13
COG4172534 ABC-type uncharacterized transport system, duplica 99.12
COG0645170 Predicted kinase [General function prediction only 99.12
PRK05439311 pantothenate kinase; Provisional 99.12
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 99.12
PF01591222 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 99.11
COG1123 539 ATPase components of various ABC-type transport sy 99.11
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.1
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 99.1
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.1
COG4619223 ABC-type uncharacterized transport system, ATPase 99.1
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 99.1
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.1
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 99.1
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 99.1
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.09
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 99.09
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.09
PRK04220301 2-phosphoglycerate kinase; Provisional 99.09
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.09
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 99.08
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 99.08
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.08
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.07
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 99.07
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.07
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.07
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.06
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.06
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.05
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.05
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.05
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.05
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.05
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 99.04
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.04
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.04
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.03
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 99.02
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.02
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.02
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.02
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.02
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.01
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.01
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.01
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.01
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.01
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 99.01
TIGR03575 340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 99.01
PLN02318 656 phosphoribulokinase/uridine kinase 99.01
PRK10938 490 putative molybdenum transport ATP-binding protein 99.0
COG4586325 ABC-type uncharacterized transport system, ATPase 99.0
PRK15453290 phosphoribulokinase; Provisional 99.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 98.99
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 98.99
PRK10619257 histidine/lysine/arginine/ornithine transporter su 98.99
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 98.99
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 98.98
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 98.98
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 98.98
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 98.98
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 98.98
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 98.98
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 98.98
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 98.98
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 98.98
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 98.98
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 98.98
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 98.97
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 98.97
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 98.97
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 98.97
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 98.97
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 98.97
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 98.97
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 98.96
PF00005137 ABC_tran: ABC transporter This structure is on hol 98.96
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 98.96
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 98.96
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 98.96
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 98.96
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 98.96
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 98.96
PLN02772398 guanylate kinase 98.95
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 98.95
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 98.95
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 98.95
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 98.95
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 98.94
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 98.94
COG4152300 ABC-type uncharacterized transport system, ATPase 98.94
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 98.94
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 98.94
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 98.94
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 98.93
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 98.93
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 98.93
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 98.93
PRK12337475 2-phosphoglycerate kinase; Provisional 98.93
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 98.93
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 98.93
COG4988559 CydD ABC-type transport system involved in cytochr 98.93
PLN032321495 ABC transporter C family member; Provisional 98.92
PRK10253265 iron-enterobactin transporter ATP-binding protein; 98.92
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 98.92
cd03246173 ABCC_Protease_Secretion This family represents the 98.92
PTZ002651466 multidrug resistance protein (mdr1); Provisional 98.92
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 98.92
COG4133209 CcmA ABC-type transport system involved in cytochr 98.92
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 98.92
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 98.92
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 98.92
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 98.92
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 98.92
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 98.92
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 98.92
PRK10790592 putative multidrug transporter membrane\ATP-bindin 98.91
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 98.91
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 98.91
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 98.91
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 98.91
PLN03130 1622 ABC transporter C family member; Provisional 98.91
PRK09984262 phosphonate/organophosphate ester transporter subu 98.91
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 98.91
cd03269210 ABC_putative_ATPase This subfamily is involved in 98.91
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 98.91
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 98.91
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 98.91
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 98.9
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 98.9
PRK10908222 cell division protein FtsE; Provisional 98.9
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 98.9
TIGR01187 325 potA spermidine/putrescine ABC transporter ATP-bin 98.9
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 98.9
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 98.9
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 98.9
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 98.89
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 98.89
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 98.89
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 98.89
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 98.89
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 98.89
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 98.89
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 98.89
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 98.89
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 98.89
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 98.88
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 98.88
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 98.88
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 98.88
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 98.88
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 98.88
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 98.88
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 98.87
COG4598256 HisP ABC-type histidine transport system, ATPase c 98.87
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 98.87
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 98.87
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 98.87
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 98.87
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 98.86
PRK10522547 multidrug transporter membrane component/ATP-bindi 98.86
COG4161242 ArtP ABC-type arginine transport system, ATPase co 98.86
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 98.86
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 98.86
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 98.86
cd03216163 ABC_Carb_Monos_I This family represents the domain 98.86
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 98.86
COG4987573 CydC ABC-type transport system involved in cytochr 98.86
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 98.86
COG1119257 ModF ABC-type molybdenum transport system, ATPase 98.86
PRK10261 623 glutathione transporter ATP-binding protein; Provi 98.86
PHA03136 378 thymidine kinase; Provisional 98.86
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 98.86
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 98.86
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 98.86
COG4181228 Predicted ABC-type transport system involved in ly 98.86
PRK10261623 glutathione transporter ATP-binding protein; Provi 98.85
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 98.85
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 98.85
COG4618580 ArpD ABC-type protease/lipase transport system, AT 98.85
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 98.85
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 98.85
PHA00729226 NTP-binding motif containing protein 98.84
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 98.84
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 98.84
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 98.84
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 98.84
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 98.84
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 98.84
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 98.84
PRK15064530 ABC transporter ATP-binding protein; Provisional 98.84
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 98.84
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 98.83
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 98.83
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 98.82
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 98.82
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 98.82
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 98.82
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 98.82
COG4167267 SapF ABC-type antimicrobial peptide transport syst 98.82
COG3709192 Uncharacterized component of phosphonate metabolis 98.82
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 98.82
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 98.82
COG2884223 FtsE Predicted ATPase involved in cell division [C 98.81
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 98.81
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 98.81
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 98.81
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 98.81
PRK14242253 phosphate transporter ATP-binding protein; Provisi 98.81
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 98.81
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 98.8
cd03215182 ABC_Carb_Monos_II This family represents domain II 98.8
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 98.8
KOG3308225 consensus Uncharacterized protein of the uridine k 98.8
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 98.79
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 98.79
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 98.79
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 98.79
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 98.78
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 98.78
PRK13409590 putative ATPase RIL; Provisional 98.78
PRK10789569 putative multidrug transporter membrane\ATP-bindin 98.78
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 98.78
PRK15064 530 ABC transporter ATP-binding protein; Provisional 98.78
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 98.78
PRK11288501 araG L-arabinose transporter ATP-binding protein; 98.77
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 98.77
PTZ002431560 ABC transporter; Provisional 98.77
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 98.77
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 98.77
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 98.76
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 98.76
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 98.76
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 98.76
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 98.76
PLN03073718 ABC transporter F family; Provisional 98.75
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 98.75
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 98.75
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 98.75
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 98.75
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 98.75
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 98.75
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 98.75
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 98.75
PRK11819556 putative ABC transporter ATP-binding protein; Revi 98.75
COG4639168 Predicted kinase [General function prediction only 98.75
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 98.74
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 98.74
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 98.74
PRK13409 590 putative ATPase RIL; Provisional 98.74
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 98.74
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 98.74
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 98.74
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 98.74
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 98.73
PRK10762501 D-ribose transporter ATP binding protein; Provisio 98.73
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 98.73
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 98.73
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 98.73
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 98.72
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 98.72
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 98.72
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 98.72
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 98.72
PRK09700510 D-allose transporter ATP-binding protein; Provisio 98.72
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 98.72
PRK03695248 vitamin B12-transporter ATPase; Provisional 98.71
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 98.71
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 98.71
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 98.71
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 98.7
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 98.7
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 98.7
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 98.7
COG3845 501 ABC-type uncharacterized transport systems, ATPase 98.7
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 98.7
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 98.69
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 98.68
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 98.68
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 98.68
cd03299235 ABC_ModC_like Archeal protein closely related to M 98.68
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 98.68
PRK14238271 phosphate transporter ATP-binding protein; Provisi 98.68
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 98.68
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 98.68
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 98.68
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 98.67
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 98.67
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 98.66
PLN03232 1495 ABC transporter C family member; Provisional 98.66
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 98.66
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 98.66
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 98.66
COG0488530 Uup ATPase components of ABC transporters with dup 98.65
PRK14237267 phosphate transporter ATP-binding protein; Provisi 98.65
PRK14239252 phosphate transporter ATP-binding protein; Provisi 98.65
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 98.64
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 98.64
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 98.64
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 98.63
COG0488 530 Uup ATPase components of ABC transporters with dup 98.63
PRK14235267 phosphate transporter ATP-binding protein; Provisi 98.63
PRK11147635 ABC transporter ATPase component; Reviewed 98.62
cd03234226 ABCG_White The White subfamily represents ABC tran 98.62
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 98.62
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 98.62
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 98.62
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 98.61
PLN02165 334 adenylate isopentenyltransferase 98.61
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 98.61
PLN03130 1622 ABC transporter C family member; Provisional 98.61
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 98.61
PRK14241258 phosphate transporter ATP-binding protein; Provisi 98.6
COG4559259 ABC-type hemin transport system, ATPase component 98.59
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 98.58
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 98.57
>KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=3e-36  Score=208.06  Aligned_cols=185  Identities=54%  Similarity=0.939  Sum_probs=174.3

Q ss_pred             CCCceEEEEEcCCCCChHHHHHHHHHHhCCceechhHHHHHHHhc-CChhhHHHHHHhhcCCCCCHHHHHHHHHHHHhcC
Q 029287            6 GKGPFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIAS-NSEYGTTILNTIKEGKIVPSEVTVSLIQKEMESS   84 (196)
Q Consensus         6 ~~~~~~i~i~G~~GsGKST~~~~L~~~~~~~~i~~~~~~~~~~~~-~~~~~~~~~~~l~~~~~~~~~~~~~~i~~~l~~~   84 (196)
                      ..++.+|.+.|+|||||-|+|..+.++||+.|++.|+++|++... +++.+..+++++..|..++...+..++.+.+...
T Consensus         5 ~~~~~IifVlGGPGsgKgTqC~kiv~ky~ftHlSaGdLLR~E~~~~gse~g~~I~~~i~~G~iVP~ei~~~LL~~am~~~   84 (195)
T KOG3079|consen    5 LDKPPIIFVLGGPGSGKGTQCEKIVEKYGFTHLSAGDLLRAEIASAGSERGALIKEIIKNGDLVPVEITLSLLEEAMRSS   84 (195)
T ss_pred             ccCCCEEEEEcCCCCCcchHHHHHHHHcCceeecHHHHHHHHHccccChHHHHHHHHHHcCCcCcHHHHHHHHHHHHHhc
Confidence            456789999999999999999999999999999999999999887 8999999999999999999999999999999976


Q ss_pred             CC-CcEEEeCCCCCHHHHHHHHHHhCCCCcEEEEeecChHHHHHHHhhccCC--CCCCcHHHHHHHHHHHHhchHhHHHH
Q 029287           85 DS-KKFLIDGFPRSEENRAAFERIMGAEPDIVLFFDCPEEEMVNRVLNRNEG--RVDDNIDTVRKRLQVFKALNLPVINY  161 (196)
Q Consensus        85 ~~-~~~iid~~~~~~~~~~~~~~~~~~~p~~~i~ld~~~~~~~~Rl~~r~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (196)
                      .. .++++||||...+|...|.+.+...|++++||||+.+++.+|+..|.+.  |.+++.+.+++|++.|.....+++++
T Consensus        85 ~~~~~fLIDGyPR~~~q~~~fe~~i~~~~~fvl~fdc~ee~~l~Rll~R~q~~~R~DDn~esikkR~et~~~~t~Pvi~~  164 (195)
T KOG3079|consen   85 GDSNGFLIDGYPRNVDQLVEFERKIQGDPDFVLFFDCPEETMLKRLLHRGQSNSRSDDNEESIKKRLETYNKSTLPVIEY  164 (195)
T ss_pred             CCCCeEEecCCCCChHHHHHHHHHhcCCCCEEEEEeCCHHHHHHHHHhhcccCCCCCCchHHHHHHHHHHHHcchHHHHH
Confidence            65 5599999999999999999998888999999999999999999999766  88999999999999999999999999


Q ss_pred             HHhcCcEEEEeCCCCHhHHHHHHHHHHHh
Q 029287          162 YARRGKLYTINAVGTVDEIFEQVRAVFAA  190 (196)
Q Consensus       162 ~~~~~~~~~I~~~~~~~~v~~~i~~~i~~  190 (196)
                      |..++.++.|+++.++++|+.++...+..
T Consensus       165 ~e~kg~l~~i~a~~~~d~Vf~~v~~~id~  193 (195)
T KOG3079|consen  165 YEKKGKLLKINAERSVDDVFEEVVTAIDA  193 (195)
T ss_pred             HHccCcEEEecCCCCHHHHHHHHHHHhhc
Confidence            99999999999999999999999888764



>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>KOG3078 consensus Adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>KOG3327 consensus Thymidylate kinase/adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>KOG4235 consensus Mitochondrial thymidine kinase 2/deoxyguanosine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PHA03132 thymidine kinase; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion] Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PHA03136 thymidine kinase; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query196
1tev_A196 Crystal Structure Of The Human UmpCMP KINASE IN OPE 7e-46
1uky_A203 Substrate Specificity And Assembly Of Catalytic Cen 2e-42
3adk_A195 Refined Structure Of Porcine Cytosolic Adenylate Ki 3e-41
1z83_A196 Crystal Structure Of Human Ak1a In Complex With Ap5 3e-41
1qf9_A194 Ph Influences Fluoride Coordination Number Of The A 3e-41
2bwj_A199 Structure Of Adenylate Kinase 5 Length = 199 6e-39
3umf_A217 Schistosoma Mansoni Adenylate Kinase Length = 217 1e-34
1p4s_A181 Solution Structure Of Mycobacterium Tuberculosis Ad 1e-27
2cdn_A201 Crystal Structure Of Mycobacterium Tuberculosis Ade 1e-27
3cm0_A186 Crystal Structure Of Adenylate Kinase From Thermus 3e-25
1ak2_A233 Adenylate Kinase Isoenzyme-2 Length = 233 7e-25
2c9y_A242 Structure Of Human Adenylate Kinase 2 Length = 242 2e-24
3tlx_A243 Crystal Structure Of Pf10_0086, Adenylate Kinase Fr 3e-24
2rgx_A206 Crystal Structure Of Adenylate Kinase From Aquifex 4e-23
2ar7_A246 Crystal Structure Of Human Adenylate Kinase 4, Ak4 5e-23
1zak_A222 Adenylate Kinase From Maize In Complex With The Inh 2e-22
1ake_A214 Structure Of The Complex Between Adenylate Kinase F 2e-22
3hpr_A214 Crystal Structure Of V148g Adenylate Kinase From E. 2e-22
3ndp_A231 Crystal Structure Of Human Ak4(L171p) Length = 231 3e-22
3fb4_A216 Crystal Structure Of Adenylate Kinase From Mariniba 3e-22
2ak3_A226 The Three-Dimensional Structure Of The Complex Betw 6e-22
1zin_A217 Adenylate Kinase With Bound Ap5a Length = 217 8e-22
1s3g_A217 Crystal Structure Of Adenylate Kinase From Bacillus 8e-22
3dkv_A217 Crystal Structure Of Adenylate Kinase Variant Aklse 1e-21
1e4v_A214 Mutant G10v Of Adenylate Kinase From E. Coli, Modif 2e-21
3be4_A217 Crystal Structure Of Cryptosporidium Parvum Adenyla 1e-20
1p3j_A217 Adenylate Kinase From Bacillus Subtilis Length = 21 3e-20
2ori_A216 Crystal Structure Of A Thermostable Mutant Of Bacil 3e-20
3dl0_A216 Crystal Structure Of Adenylate Kinase Variant Aklse 3e-20
2eu8_A216 Crystal Structure Of A Thermostable Mutant Of Bacil 4e-20
1e4y_A214 Mutant P9l Of Adenylate Kinase From E. Coli, Modifi 4e-20
2qaj_A217 Crystal Structure Of A Thermostable Mutant Of Bacil 5e-20
2p3s_A217 Crystal Structure Of A Thermostable Mutant Of Bacil 6e-20
1zd8_A227 Structure Of Human Adenylate Kinase 3 Like 1 Length 7e-20
2oo7_A217 Crystal Structure Of A Thermostable Mutant Of Bacil 8e-20
2osb_A216 Crystal Structure Of A Thermostable Mutant Of Bacil 3e-19
3gmt_A230 Crystal Structure Of Adenylate Kinase From Burkhold 3e-19
3aky_A220 Stability, Activity And Structure Of Adenylate Kina 2e-16
1aky_A220 High-Resolution Structures Of Adenylate Kinase From 2e-16
1dvr_A220 Structure Of A Mutant Adenylate Kinase Ligated With 4e-15
2xb4_A223 Crystal Structures Of Zinc Containing Adenylate Kin 5e-13
3l0p_A223 Crystal Structures Of Iron Containing Adenylate Kin 5e-13
>pdb|1TEV|A Chain A, Crystal Structure Of The Human UmpCMP KINASE IN OPEN Conformation Length = 196 Back     alignment and structure

Iteration: 1

Score = 179 bits (455), Expect = 7e-46, Method: Compositional matrix adjust. Identities = 91/190 (47%), Positives = 129/190 (67%), Gaps = 10/190 (5%) Query: 9 PFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIAS-NSEYGTTILNTIKEGKI 67 P + FVLGGPG+GKGTQCA+IV+ YG THLSAGELLR E + +S+YG I IKEGKI Sbjct: 3 PLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKI 62 Query: 68 VPSEVTVSLIQKEME-----SSDSKKFLIDGFPRSEENRAAFERIMGAEPDI--VLFFDC 120 VP E+T+SL+++EM+ ++ KFLIDGFPR+++N + + M + D+ VLFFDC Sbjct: 63 VPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDC 122 Query: 121 PEEEMVNRVLNR--NEGRVDDNIDTVRKRLQVFKALNLPVINYYARRGKLYTINAVGTVD 178 E + R L R + GR DDN +++ KR+Q + P+I+ Y GK+ I+A +VD Sbjct: 123 NNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVD 182 Query: 179 EIFEQVRAVF 188 E+F++V +F Sbjct: 183 EVFDEVVQIF 192
>pdb|1UKY|A Chain A, Substrate Specificity And Assembly Of Catalytic Center Derived From Two Structures Of Ligated Uridylate Kinase Length = 203 Back     alignment and structure
>pdb|3ADK|A Chain A, Refined Structure Of Porcine Cytosolic Adenylate Kinase At 2.1 Angstroms Resolution Length = 195 Back     alignment and structure
>pdb|1Z83|A Chain A, Crystal Structure Of Human Ak1a In Complex With Ap5a Length = 196 Back     alignment and structure
>pdb|1QF9|A Chain A, Ph Influences Fluoride Coordination Number Of The Alfx Phosphoryl Transfer Transition State Analog In UmpCMP Kinase Length = 194 Back     alignment and structure
>pdb|2BWJ|A Chain A, Structure Of Adenylate Kinase 5 Length = 199 Back     alignment and structure
>pdb|3UMF|A Chain A, Schistosoma Mansoni Adenylate Kinase Length = 217 Back     alignment and structure
>pdb|1P4S|A Chain A, Solution Structure Of Mycobacterium Tuberculosis Adenylate Kinase Length = 181 Back     alignment and structure
>pdb|2CDN|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Adenylate Kinase Complexed With Two Molecules Of Adp And Mg Length = 201 Back     alignment and structure
>pdb|3CM0|A Chain A, Crystal Structure Of Adenylate Kinase From Thermus Thermophilus Hb8 Length = 186 Back     alignment and structure
>pdb|1AK2|A Chain A, Adenylate Kinase Isoenzyme-2 Length = 233 Back     alignment and structure
>pdb|2C9Y|A Chain A, Structure Of Human Adenylate Kinase 2 Length = 242 Back     alignment and structure
>pdb|3TLX|A Chain A, Crystal Structure Of Pf10_0086, Adenylate Kinase From Plasmodium Falciparum Length = 243 Back     alignment and structure
>pdb|2RGX|A Chain A, Crystal Structure Of Adenylate Kinase From Aquifex Aeolicus In Complex With Ap5a Length = 206 Back     alignment and structure
>pdb|2AR7|A Chain A, Crystal Structure Of Human Adenylate Kinase 4, Ak4 Length = 246 Back     alignment and structure
>pdb|1ZAK|A Chain A, Adenylate Kinase From Maize In Complex With The Inhibitor P1,P5-Bis(Adenosine-5'-)pentaphosphate (Ap5a) Length = 222 Back     alignment and structure
>pdb|1AKE|A Chain A, Structure Of The Complex Between Adenylate Kinase From Escherichia Coli And The Inhibitor Ap5a Refined At 1.9 Angstroms Resolution: A Model For A Catalytic Transition State Length = 214 Back     alignment and structure
>pdb|3HPR|A Chain A, Crystal Structure Of V148g Adenylate Kinase From E. Coli, In Complex With Ap5a Length = 214 Back     alignment and structure
>pdb|3NDP|A Chain A, Crystal Structure Of Human Ak4(L171p) Length = 231 Back     alignment and structure
>pdb|3FB4|A Chain A, Crystal Structure Of Adenylate Kinase From Marinibacillus Marinus Length = 216 Back     alignment and structure
>pdb|2AK3|A Chain A, The Three-Dimensional Structure Of The Complex Between Mitochondrial Matrix Adenylate Kinase And Its Substrate Amp At 1.85 Angstroms Resolution Length = 226 Back     alignment and structure
>pdb|1ZIN|A Chain A, Adenylate Kinase With Bound Ap5a Length = 217 Back     alignment and structure
>pdb|1S3G|A Chain A, Crystal Structure Of Adenylate Kinase From Bacillus Globisporus Length = 217 Back     alignment and structure
>pdb|3DKV|A Chain A, Crystal Structure Of Adenylate Kinase Variant Aklse1 Length = 217 Back     alignment and structure
>pdb|1E4V|A Chain A, Mutant G10v Of Adenylate Kinase From E. Coli, Modified In The Gly-Loop Length = 214 Back     alignment and structure
>pdb|3BE4|A Chain A, Crystal Structure Of Cryptosporidium Parvum Adenylate Kinase Cgd5_3360 Length = 217 Back     alignment and structure
>pdb|1P3J|A Chain A, Adenylate Kinase From Bacillus Subtilis Length = 217 Back     alignment and structure
>pdb|2ORI|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (A193vQ199R) Length = 216 Back     alignment and structure
>pdb|3DL0|A Chain A, Crystal Structure Of Adenylate Kinase Variant Aklse3 Length = 216 Back     alignment and structure
>pdb|2EU8|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (Q199r) Length = 216 Back     alignment and structure
>pdb|1E4Y|A Chain A, Mutant P9l Of Adenylate Kinase From E. Coli, Modified In The Gly-Loop Length = 214 Back     alignment and structure
>pdb|2QAJ|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (Q199rG213E) Length = 217 Back     alignment and structure
>pdb|2P3S|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (G214rQ199R) Length = 217 Back     alignment and structure
>pdb|1ZD8|A Chain A, Structure Of Human Adenylate Kinase 3 Like 1 Length = 227 Back     alignment and structure
>pdb|2OO7|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (T179iQ199R) Length = 217 Back     alignment and structure
>pdb|2OSB|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (q16l/q199r/) Length = 216 Back     alignment and structure
>pdb|3GMT|A Chain A, Crystal Structure Of Adenylate Kinase From Burkholderia Pseu Length = 230 Back     alignment and structure
>pdb|3AKY|A Chain A, Stability, Activity And Structure Of Adenylate Kinase Mutants Length = 220 Back     alignment and structure
>pdb|1AKY|A Chain A, High-Resolution Structures Of Adenylate Kinase From Yeast Ligated With Inhibitor Ap5a, Showing The Pathway Of Phosphoryl Transfer Length = 220 Back     alignment and structure
>pdb|1DVR|A Chain A, Structure Of A Mutant Adenylate Kinase Ligated With An Atp- Analogue Showing Domain Closure Over Atp Length = 220 Back     alignment and structure
>pdb|2XB4|A Chain A, Crystal Structures Of Zinc Containing Adenylate Kinase From Desulfovibrio Gigas Length = 223 Back     alignment and structure
>pdb|3L0P|A Chain A, Crystal Structures Of Iron Containing Adenylate Kinase From Desulfovibrio Gigas Length = 223 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query196
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 2e-93
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 4e-91
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 1e-90
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 1e-87
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 4e-87
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 3e-56
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 9e-56
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 1e-54
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 2e-54
3tlx_A243 Adenylate kinase 2; structural genomics, structura 2e-54
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 4e-54
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 6e-54
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 6e-54
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 4e-53
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 4e-53
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 6e-53
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 3e-52
2rgx_A206 Adenylate kinase; transferase(phosphotransferase), 3e-52
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 2e-51
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 3e-45
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 7e-26
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 1e-19
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 3e-10
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 2e-09
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 2e-08
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 3e-07
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 6e-07
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 7e-07
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 3e-05
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 7e-05
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 1e-04
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 2e-04
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 2e-04
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 4e-04
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 8e-04
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Length = 194 Back     alignment and structure
 Score =  269 bits (691), Expect = 2e-93
 Identities = 88/187 (47%), Positives = 122/187 (65%), Gaps = 4/187 (2%)

Query: 9   PFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKEGKIV 68
           P + FVLGGPGSGKGTQCA IV+++G  HLSAG+LLR+E  S S+ G  I   IK G+IV
Sbjct: 6   PNVVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGEIV 65

Query: 69  PSEVTVSLIQKEMESSDSKKFLIDGFPRSEENRAAFERIMG--AEPDIVLFFDCPEEEMV 126
           PS VTV L++  ++++  K FL+DGFPR+EEN  ++E  M    +   VLFFDCPEE M 
Sbjct: 66  PSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEVMT 125

Query: 127 NRVLNRN--EGRVDDNIDTVRKRLQVFKALNLPVINYYARRGKLYTINAVGTVDEIFEQV 184
            R+L R    GR DDNI++++KR   F      VI++Y +  K+  I A   V+E++  V
Sbjct: 126 QRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDV 185

Query: 185 RAVFAAL 191
             +F ++
Sbjct: 186 ENLFKSM 192


>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Length = 196 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Length = 199 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Length = 203 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Length = 196 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Length = 186 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Length = 201 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Length = 216 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, cytoplasm, metal-binding, nucleotide biosynthesis, nucleotide-binding; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Length = 216 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Length = 243 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Length = 217 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Length = 246 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Length = 233 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Length = 222 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Length = 227 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Length = 220 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Length = 214 Back     alignment and structure
>2rgx_A Adenylate kinase; transferase(phosphotransferase), ATP-binding, nucleo binding, transferase; HET: AP5; 1.90A {Aquifex aeolicus} PDB: 2rh5_A Length = 206 Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 230 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Length = 223 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Length = 179 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Length = 189 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Length = 180 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Length = 181 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Length = 212 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Length = 184 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Length = 301 Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Length = 216 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Length = 192 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Length = 213 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Length = 214 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Length = 229 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Length = 194 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Length = 191 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query196
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 100.0
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 100.0
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 100.0
3tlx_A243 Adenylate kinase 2; structural genomics, structura 99.98
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 99.97
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 99.97
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 99.97
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 99.97
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 99.97
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 99.97
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 99.96
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 99.96
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 99.96
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 99.96
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 99.96
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 99.96
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 99.96
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 99.96
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 99.96
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 99.95
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 99.91
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 99.9
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 99.89
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 99.88
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 99.87
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 99.86
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 99.86
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 99.85
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 99.84
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 99.84
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 99.84
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 99.83
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 99.83
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 99.83
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 99.82
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 99.8
3vaa_A199 Shikimate kinase, SK; structural genomics, center 99.79
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 99.78
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 99.78
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 99.78
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 99.78
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 99.78
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 99.77
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 99.77
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 99.76
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 99.76
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 99.76
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 99.76
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 99.76
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 99.75
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 99.74
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 99.74
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 99.74
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 99.73
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 99.72
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 99.72
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 99.71
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 99.7
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 99.7
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 99.7
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 99.7
2vli_A183 Antibiotic resistance protein; transferase, tunica 99.69
1via_A175 Shikimate kinase; structural genomics, transferase 99.69
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 99.68
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 99.68
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 99.67
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 99.66
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 99.65
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 99.65
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 99.65
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 99.65
1kag_A173 SKI, shikimate kinase I; transferase, structural g 99.62
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 99.62
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 99.62
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 99.62
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 99.58
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 99.58
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 99.57
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 99.57
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 99.56
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 99.55
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 99.52
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 99.49
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 99.48
3r20_A233 Cytidylate kinase; structural genomics, seattle st 99.48
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 99.44
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 99.42
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 99.41
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 99.4
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 99.37
1p6x_A334 Thymidine kinase; P-loop, LID, transferase; HET: T 99.36
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 99.35
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 99.33
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.33
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 99.32
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 99.3
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.29
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.28
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 99.27
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 99.27
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 99.26
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 99.26
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 99.25
1of1_A376 Thymidine kinase; transferase, antiviral drug, enz 99.25
1e2k_A331 Thymidine kinase; transferase, antiviral drug, enz 99.23
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 99.21
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 99.2
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 99.2
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 99.2
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 99.19
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 99.19
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 99.19
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 99.19
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 99.18
1osn_A341 Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra 99.18
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.17
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.17
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 99.17
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.16
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.16
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 99.15
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.14
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 99.13
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 99.13
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 99.09
3czq_A304 Putative polyphosphate kinase 2; structural genomi 99.09
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 99.08
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 99.06
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 99.06
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 99.06
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.05
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 99.04
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 99.04
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.04
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 99.02
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 99.02
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.02
1g6h_A257 High-affinity branched-chain amino acid transport 99.02
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 99.02
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 99.0
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 98.96
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 98.96
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.95
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 98.95
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 98.95
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 98.94
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 98.94
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 98.93
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 98.93
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 98.92
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 98.9
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 98.87
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.86
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 98.85
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 98.82
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 98.82
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 98.81
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 98.78
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 98.78
2ghi_A260 Transport protein; multidrug resistance protein, M 98.77
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.77
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 98.77
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 98.76
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 98.75
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 98.74
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 98.74
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 98.74
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 98.73
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 98.72
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 98.72
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 98.72
3czp_A 500 Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 98.72
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 98.71
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 98.7
3czp_A500 Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 98.68
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 98.67
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.62
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 98.61
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 98.6
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.57
1dek_A241 Deoxynucleoside monophosphate kinase; transferase, 98.48
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 98.47
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 98.47
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 98.45
3rhf_A289 Putative polyphosphate kinase 2 family protein; PS 98.43
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 98.42
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 98.39
2og2_A359 Putative signal recognition particle receptor; nuc 98.38
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.29
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 98.29
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 98.27
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 98.23
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.2
1vma_A306 Cell division protein FTSY; TM0570, structural gen 98.17
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 98.13
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 98.12
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 98.11
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 98.1
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 98.1
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 98.1
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 98.08
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 98.05
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.04
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.03
1xjc_A169 MOBB protein homolog; structural genomics, midwest 97.98
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 97.95
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.94
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.93
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 97.92
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 97.92
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.91
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 97.91
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 97.91
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.9
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 97.88
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.88
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 97.87
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 97.86
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 97.86
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 97.85
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.84
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.84
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.83
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.83
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.83
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 97.81
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.81
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.8
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.79
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.78
1kjw_A295 Postsynaptic density protein 95; protein-protein i 97.76
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 97.76
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.75
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 97.75
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 97.74
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 97.74
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 97.73
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 97.72
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 97.72
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 97.72
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.71
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 97.71
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.71
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 97.7
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 97.7
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 97.67
3kta_A182 Chromosome segregation protein SMC; structural mai 97.66
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.65
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 97.65
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.65
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 97.64
2ewv_A372 Twitching motility protein PILT; pilus retraction 97.64
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.62
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 97.62
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 97.61
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 97.61
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.61
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.61
2r62_A268 Cell division protease FTSH homolog; ATPase domain 97.6
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 97.6
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 97.59
1p9r_A418 General secretion pathway protein E; bacterial typ 97.59
3bos_A242 Putative DNA replication factor; P-loop containing 97.59
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.58
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.57
1nrj_B218 SR-beta, signal recognition particle receptor beta 97.57
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 97.56
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 97.56
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.55
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.55
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 97.55
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 97.54
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 97.54
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 97.53
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.53
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 97.52
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 97.51
2www_A349 Methylmalonic aciduria type A protein, mitochondri 97.51
1tue_A212 Replication protein E1; helicase, replication, E1E 97.5
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 97.5
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.5
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 97.49
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.49
2wji_A165 Ferrous iron transport protein B homolog; membrane 97.48
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 97.48
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 97.48
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 97.48
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 97.47
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 97.47
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.47
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.47
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.46
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 97.46
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.46
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.44
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 97.43
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 97.43
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 97.43
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 97.43
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 97.42
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.42
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.42
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 97.41
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 97.4
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 97.39
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 97.39
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 97.39
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 97.39
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 97.39
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 97.39
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.39
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 97.38
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 97.38
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 97.38
2chg_A226 Replication factor C small subunit; DNA-binding pr 97.37
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.37
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 97.37
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 97.36
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 97.35
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 97.35
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 97.35
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 97.34
3lxx_A239 GTPase IMAP family member 4; structural genomics c 97.34
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 97.33
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 97.33
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 97.33
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 97.33
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 97.32
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 97.32
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 97.32
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 97.31
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 97.31
3pvs_A 447 Replication-associated recombination protein A; ma 97.3
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 97.3
2oap_1511 GSPE-2, type II secretion system protein; hexameri 97.3
2hf9_A226 Probable hydrogenase nickel incorporation protein 97.3
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 97.3
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 97.3
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 97.3
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 97.29
2ged_A193 SR-beta, signal recognition particle receptor beta 97.29
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 97.28
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 97.28
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 97.28
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 97.28
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 97.27
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 97.27
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 97.27
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 97.27
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 97.27
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 97.27
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.26
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 97.25
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 97.25
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.25
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 97.25
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.25
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 97.25
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 97.24
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 97.24
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.24
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 97.23
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 97.23
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 97.23
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 97.22
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 97.22
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.22
3t1o_A198 Gliding protein MGLA; G domain containing protein, 97.22
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 97.21
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 97.21
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 97.2
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 97.2
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 97.2
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 97.2
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 97.19
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 97.18
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 97.18
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 97.17
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 97.17
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 97.17
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 97.17
2r44_A331 Uncharacterized protein; putative ATPase, structur 97.17
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 97.16
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 97.16
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 97.16
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 97.16
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 97.15
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 97.15
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 97.15
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 97.15
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 97.14
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 97.13
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 97.13
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 97.13
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 97.13
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 97.12
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 97.12
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 97.12
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 97.12
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 97.11
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.11
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 97.11
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 97.11
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 97.1
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.1
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 97.09
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 97.09
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 97.09
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 97.08
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 97.08
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 97.08
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 97.07
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 97.07
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 97.06
2qgz_A308 Helicase loader, putative primosome component; str 97.06
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 97.06
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 97.06
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 97.06
3lxw_A247 GTPase IMAP family member 1; immunity, structural 97.05
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 97.05
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 97.05
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 97.05
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 97.05
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 97.04
3qkt_A 339 DNA double-strand break repair RAD50 ATPase; RECA- 97.04
1e69_A 322 Chromosome segregation SMC protein; structural mai 97.04
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 97.04
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 97.03
2fh5_B214 SR-beta, signal recognition particle receptor beta 97.03
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 97.03
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 97.03
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 97.03
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 97.03
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 97.03
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 97.02
3co5_A143 Putative two-component system transcriptional RES 97.02
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 97.02
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 97.02
2xkx_A721 Disks large homolog 4; structural protein, scaffol 97.02
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 97.02
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 97.01
2o5v_A 359 DNA replication and repair protein RECF; ABC ATPas 97.01
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 97.01
2xxa_A 433 Signal recognition particle protein; protein trans 97.0
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.0
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 97.0
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 97.0
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.0
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.98
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 96.98
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 96.98
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 96.98
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 96.97
4dey_A337 Voltage-dependent L-type calcium channel subunit; 96.97
1zcb_A 362 G alpha I/13; GTP-binding, lipoprotein, membrane, 96.97
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 96.96
2chq_A319 Replication factor C small subunit; DNA-binding pr 96.95
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 96.95
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 96.95
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 96.94
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 96.94
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 96.94
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 96.94
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 96.92
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 96.92
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 96.91
3llu_A196 RAS-related GTP-binding protein C; structural geno 96.91
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.91
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 96.9
3iby_A256 Ferrous iron transport protein B; G protein, G dom 96.89
4aby_A415 DNA repair protein RECN; hydrolase, double strand 96.89
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 96.89
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 96.88
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 96.88
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 96.88
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 96.87
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 96.87
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 96.86
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 96.86
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 96.85
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 96.85
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 96.83
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 96.83
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 96.82
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 96.81
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 96.81
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 96.8
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.8
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 96.8
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 96.8
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.79
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 96.78
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 96.76
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 96.76
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 96.73
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 96.73
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 96.71
1knx_A312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 96.69
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 96.68
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 96.68
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
Probab=100.00  E-value=7.8e-37  Score=223.02  Aligned_cols=189  Identities=41%  Similarity=0.674  Sum_probs=169.1

Q ss_pred             ccCCCCceEEEEEcCCCCChHHHHHHHHHHhCCceechhHHHHHHHhcCChhhHHHHHHhhcCCCCCHHHHHHHHHHHHh
Q 029287            3 VKGGKGPFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKEGKIVPSEVTVSLIQKEME   82 (196)
Q Consensus         3 ~~~~~~~~~i~i~G~~GsGKST~~~~L~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~i~~~l~   82 (196)
                      ....+++++|+|.|||||||+|+|+.|+++||+.+++.|+++|..+...++.+..+++++..|..++++.+...+.+.+.
T Consensus        23 ~~~~~k~kiI~llGpPGsGKgTqa~~L~~~~g~~hIstGdllR~~i~~~t~lg~~~~~~~~~G~lVpde~~~~lv~~~l~  102 (217)
T 3umf_A           23 DQKLAKAKVIFVLGGPGSGKGTQCEKLVQKFHFNHLSSGDLLRAEVQSGSPKGKELKAMMERGELVPLEVVLALLKEAMI  102 (217)
T ss_dssp             -CCTTSCEEEEEECCTTCCHHHHHHHHHHHHCCEEECHHHHHHHHHTTCCHHHHHHHHHHHHTCCCCHHHHHHHHHHHHH
T ss_pred             chhccCCcEEEEECCCCCCHHHHHHHHHHHHCCceEcHHHHHHHHHHcCCchHHHHHHHHhcCCCCCHHHHHHHHHHHHh
Confidence            34456778999999999999999999999999999999999999999999999999999999999999999999988886


Q ss_pred             cC--CCCcEEEeCCCCCHHHHHHHHHHhCCCCcEEEEeecChHHHHHHHhhcc--CCCCCCcHHHHHHHHHHHHhchHhH
Q 029287           83 SS--DSKKFLIDGFPRSEENRAAFERIMGAEPDIVLFFDCPEEEMVNRVLNRN--EGRVDDNIDTVRKRLQVFKALNLPV  158 (196)
Q Consensus        83 ~~--~~~~~iid~~~~~~~~~~~~~~~~~~~p~~~i~ld~~~~~~~~Rl~~r~--~~~~~~~~~~~~~~~~~~~~~~~~~  158 (196)
                      ..  ...+||+||||.+..|...|...+. .++.+|+|++|.+++.+|+..|.  .+|.+|+.+.+.+|+..|.+...++
T Consensus       103 ~~~~~~~g~ilDGfPRt~~Qa~~l~~~~~-~~~~vi~l~v~~e~~~~Rl~~R~~~~~R~DD~~e~i~~Rl~~Y~~~t~pl  181 (217)
T 3umf_A          103 KLVDKNCHFLIDGYPRELDQGIKFEKEVC-PCLCVINFDVSEEVMRKRLLKRAETSNRVDDNEETIVKRFRTFNELTKPV  181 (217)
T ss_dssp             HHTTTCSEEEEETBCSSHHHHHHHHHHTC-CCSEEEEEECCHHHHHHHHSCC------CHHHHHHHHHHHHHHHHHTHHH
T ss_pred             hccccccCcccccCCCcHHHHHHHHHhCC-ccCEEEeccCCHHHHHHHHhcccccCCCCCCCHHHHHHHHHHHHHHHHHH
Confidence            42  3468999999999999999887654 78999999999999999999884  3577778999999999999999999


Q ss_pred             HHHHHhcCcEEEEeCCCCHhHHHHHHHHHHHhhh
Q 029287          159 INYYARRGKLYTINAVGTVDEIFEQVRAVFAALK  192 (196)
Q Consensus       159 ~~~~~~~~~~~~I~~~~~~~~v~~~i~~~i~~~~  192 (196)
                      +++|.+.+.++.||+++++++|+++|.+.++++.
T Consensus       182 ~~~Y~~~~~l~~Idg~~~~eeV~~~I~~~l~k~G  215 (217)
T 3umf_A          182 IEHYKQQNKVITIDASGTVDAIFDKVNHELQKFG  215 (217)
T ss_dssp             HHHHHTTTCEEEEETTSCHHHHHHHHHHHHHTTT
T ss_pred             HHHHHhcCCEEEEECCCCHHHHHHHHHHHHHHcC
Confidence            9999999999999999999999999999988753



>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Back     alignment and structure
>1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3rhf_A Putative polyphosphate kinase 2 family protein; PSI-biology, MCSG, structural genomics, midwest center for S genomics; HET: PGE FLC PG4; 2.45A {Arthrobacter aurescens} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 196
d3adka_194 c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [ 1e-39
d1teva_194 c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) 4e-39
d1qf9a_194 c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoi 6e-39
d1ak2a1190 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Co 6e-39
d1s3ga1182 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bac 1e-38
d1zina1182 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bac 2e-38
d2cdna1181 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium 6e-38
d1e4va1179 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Esc 2e-34
d1ukza_196 c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Sac 7e-34
d2ak3a1189 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow 1e-33
d1zaka1189 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Mai 5e-32
d1akya1180 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Bak 9e-30
d1ly1a_152 c.37.1.1 (A:) Polynucleotide kinase, kinase domain 5e-14
d1nksa_194 c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobu 4e-13
d1khta_190 c.37.1.1 (A:) Adenylate kinase {Archaeon Methanoco 1e-12
d1y63a_174 c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishma 2e-10
d1knqa_171 c.37.1.17 (A:) Gluconate kinase {Escherichia coli 5e-10
d1rkba_173 c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien 2e-09
d1ckea_225 c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 4e-09
d2bdta1176 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B 4e-09
d1q3ta_223 c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae 2e-07
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 4e-05
d1vhta_208 c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia co 5e-05
d1lw7a2192 c.37.1.1 (A:220-411) Transcriptional regulator Nad 3e-04
d4tmka_210 c.37.1.1 (A:) Thymidylate kinase {Escherichia coli 6e-04
d1nn5a_209 c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapi 8e-04
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 9e-04
d1odfa_286 c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker' 9e-04
d1uf9a_191 c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermo 0.001
d1yj5a2172 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p 0.002
d1e6ca_170 c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chr 0.002
d1tmka_214 c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (S 0.003
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Length = 194 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Pig (Sus scrofa) [TaxId: 9823]
 Score =  131 bits (331), Expect = 1e-39
 Identities = 83/190 (43%), Positives = 119/190 (62%), Gaps = 5/190 (2%)

Query: 7   KGPFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKEGK 66
           K   I FV+GGPGSGKGTQC KIV+ YG THLS G+LLR E++S S  G  +   +++G+
Sbjct: 6   KKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSARGKMLSEIMEKGQ 65

Query: 67  IVPSEVTVSLIQKEMESSDS--KKFLIDGFPRSEENRAAFERIMGAEPDIVLFFDCPEEE 124
           +VP E  + +++  M +     K FLIDG+PR  +    FER +G +P ++L+ D   E 
Sbjct: 66  LVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQGEEFERKIG-QPTLLLYVDAGPET 124

Query: 125 MVNRVLNR--NEGRVDDNIDTVRKRLQVFKALNLPVINYYARRGKLYTINAVGTVDEIFE 182
           M  R+L R    GRVDDN +T++KRL+ +     PVI +Y +RG +  +NA G+VD++F 
Sbjct: 125 MTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDDVFS 184

Query: 183 QVRAVFAALK 192
           QV      LK
Sbjct: 185 QVCTHLDTLK 194


>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 194 Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Length = 194 Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Length = 190 Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Length = 182 Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Length = 182 Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196 Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Length = 189 Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 180 Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 194 Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 190 Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Length = 174 Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Length = 225 Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Length = 223 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Length = 208 Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 209 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 286 Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Length = 191 Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Length = 170 Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 214 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query196
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 100.0
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 100.0
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 100.0
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 99.98
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 99.98
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 99.98
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 99.97
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 99.97
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 99.97
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 99.97
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 99.97
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 99.88
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 99.87
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 99.84
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 99.81
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 99.8
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 99.8
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 99.79
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 99.79
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 99.78
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 99.78
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 99.78
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 99.76
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 99.75
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 99.73
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 99.71
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 99.7
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 99.7
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 99.69
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 99.68
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 99.66
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 99.65
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 99.64
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 99.6
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 99.59
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 99.58
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 99.58
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 99.52
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.47
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.46
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.45
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.44
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 99.43
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.43
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 99.43
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.43
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.42
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.4
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 99.38
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.37
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 99.36
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.35
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 99.35
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 99.35
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.34
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 99.33
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 99.31
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 99.31
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.29
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.29
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.29
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.25
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 99.24
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.24
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 99.23
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.22
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.2
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.17
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 99.14
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 99.11
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 99.11
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.08
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 98.96
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 98.79
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.77
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 98.64
d2axpa1164 Hypothetical protein YorR {Bacillus subtilis [TaxI 98.59
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.48
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 98.45
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 98.42
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 98.34
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.19
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 98.19
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.18
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.16
d1vmaa2213 GTPase domain of the signal recognition particle r 98.16
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 98.12
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.12
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.11
d1ls1a2207 GTPase domain of the signal sequence recognition p 98.07
d1j8yf2211 GTPase domain of the signal sequence recognition p 98.07
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 98.05
d2qy9a2211 GTPase domain of the signal recognition particle r 98.04
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 97.99
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.94
d1okkd2207 GTPase domain of the signal recognition particle r 97.93
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.92
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.91
d1svma_362 Papillomavirus large T antigen helicase domain {Si 97.87
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 97.87
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.87
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.85
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 97.75
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 97.74
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 97.74
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 97.67
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 97.63
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 97.61
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.6
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 97.6
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.59
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.59
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 97.58
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 97.57
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 97.49
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.45
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.42
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 97.42
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 97.41
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 97.41
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 97.41
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.39
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 97.36
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.34
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 97.34
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 97.34
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.33
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.33
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 97.32
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 97.27
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 97.25
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 97.25
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 97.24
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 97.24
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 97.22
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 97.22
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 97.2
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 97.2
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 97.18
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 97.18
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.18
d1nrjb_209 Signal recognition particle receptor beta-subunit 97.17
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.17
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.17
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 97.17
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 97.15
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 97.14
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 97.14
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 97.14
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 97.13
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 97.12
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 97.11
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 97.11
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 97.11
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 97.11
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 97.1
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 97.09
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 97.09
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 97.08
d2fh5b1207 Signal recognition particle receptor beta-subunit 97.07
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 97.07
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 97.07
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.07
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 97.06
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 97.06
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 97.05
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.05
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 97.04
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 97.04
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 97.04
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 97.03
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 97.02
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 97.01
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.99
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 96.99
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.98
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.98
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 96.98
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 96.98
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 96.97
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 96.97
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.96
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 96.94
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 96.94
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 96.94
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 96.94
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 96.93
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.92
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.9
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 96.9
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 96.89
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.87
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 96.87
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 96.86
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 96.85
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 96.84
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 96.82
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 96.81
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 96.79
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 96.78
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 96.75
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 96.75
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 96.72
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 96.71
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.69
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 96.67
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 96.65
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 96.64
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 96.63
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 96.6
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.59
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.54
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.53
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.5
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 96.5
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 96.49
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.48
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.48
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 96.47
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 96.47
d1tuea_205 Replication protein E1 helicase domain {Human papi 96.44
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 96.43
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 96.35
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 96.32
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 96.3
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 96.26
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.21
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 96.2
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.13
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.06
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.98
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 95.89
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 95.78
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 95.7
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 95.7
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 95.63
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 95.58
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 95.55
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 95.42
d1xpua3289 Transcription termination factor Rho, ATPase domai 95.35
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 95.34
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 95.26
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 95.16
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.11
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 95.07
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 95.0
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 94.99
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 94.98
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 94.95
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 94.88
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 94.82
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 94.77
d2olra1 313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 94.74
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 94.69
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 94.68
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 94.58
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 94.54
d1ii2a1 323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 94.53
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 94.48
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 94.44
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 94.31
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 94.29
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 94.08
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 93.81
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 93.77
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 93.63
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 93.61
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 93.54
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 93.45
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 93.38
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 93.36
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 93.3
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 93.03
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 92.82
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 92.74
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 92.56
d1e8ca3234 UDP-N-acetylmuramyl tripeptide synthetase MurE {Es 92.45
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 92.32
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 92.1
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 91.98
d1gg4a4214 UDP-murNac-tripeptide D-alanyl-D-alanine-adding en 90.93
d1j6ua3207 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 90.77
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 90.53
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 90.41
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 90.28
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 89.74
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 89.19
d2jfga3204 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 89.13
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 89.04
d1p3da3215 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 88.88
d2gc6a2296 Folylpolyglutamate synthetase {Lactobacillus casei 88.21
d1o5za2296 Folylpolyglutamate synthetase {Thermotoga maritima 87.88
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 85.02
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 84.82
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 83.46
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 83.23
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 80.8
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: UMP/CMP kinase
species: Dictyostelium discoideum [TaxId: 44689]
Probab=100.00  E-value=3.1e-32  Score=194.97  Aligned_cols=185  Identities=48%  Similarity=0.839  Sum_probs=165.3

Q ss_pred             CCceEEEEEcCCCCChHHHHHHHHHHhCCceechhHHHHHHHhcCChhhHHHHHHhhcCCCCCHHHHHHHHHHHHhcCCC
Q 029287            7 KGPFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKEGKIVPSEVTVSLIQKEMESSDS   86 (196)
Q Consensus         7 ~~~~~i~i~G~~GsGKST~~~~L~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~i~~~l~~~~~   86 (196)
                      ++|.+|+|.|||||||||+|+.|+++||+.+++.|+++++......+.+..+......+...++......+.........
T Consensus         4 ~kp~iI~i~G~pGSGKsT~a~~La~~~g~~~i~~g~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   83 (194)
T d1qf9a_           4 SKPNVVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTVKLLKNAIDANQG   83 (194)
T ss_dssp             CCCEEEEEEESTTSSHHHHHHHHHHHHCCEEEEHHHHHHHHHHTTCTTHHHHHHHHHTTCCCCHHHHHHHHHHHHHTSTT
T ss_pred             CCCcEEEEECCCCCCHHHHHHHHHHHHCCceEchhhHHHHHhhhhhhhhhhhhhHhhhccccchHHHHHHHHHHhhhhhc
Confidence            46789999999999999999999999999999999999999888888999999999999999988888888877777677


Q ss_pred             CcEEEeCCCCCHHHHHHHHHHh--CCCCcEEEEeecChHHHHHHHhhcc--CCCCCCcHHHHHHHHHHHHhchHhHHHHH
Q 029287           87 KKFLIDGFPRSEENRAAFERIM--GAEPDIVLFFDCPEEEMVNRVLNRN--EGRVDDNIDTVRKRLQVFKALNLPVINYY  162 (196)
Q Consensus        87 ~~~iid~~~~~~~~~~~~~~~~--~~~p~~~i~ld~~~~~~~~Rl~~r~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  162 (196)
                      .++++|++|.+..+...+....  ...|+++|+|++|++++.+|+.+|.  ..+..++.+.+++|+..|.....++.++|
T Consensus        84 ~~~i~dg~p~~~~~~~~l~~~~~~~~~~~~vi~l~~~~~~~~~R~~~~~~~~~~~~d~~e~~~~Rl~~y~~~~~~~~~~y  163 (194)
T d1qf9a_          84 KNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVIDHY  163 (194)
T ss_dssp             CCEEEETCCCSHHHHHHHHHHHTTTCEEEEEEEEECCHHHHHHHHHHHHTTSCCTTCSHHHHHHHHHHHHHTHHHHHHHH
T ss_pred             CCeEEEecchhhhhHHHHHhhhhhcccccEEEEeecchHHHHHHHHhhccccccccccHHHHHHHHHHHHHHHHHHHHHH
Confidence            8899999999999988887653  4568999999999999999998874  24566789999999999999999999999


Q ss_pred             HhcCcEEEEeCCCCHhHHHHHHHHHHHhh
Q 029287          163 ARRGKLYTINAVGTVDEIFEQVRAVFAAL  191 (196)
Q Consensus       163 ~~~~~~~~I~~~~~~~~v~~~i~~~i~~~  191 (196)
                      .+...+++||+++++++|+++|.+.++.+
T Consensus       164 ~~~~~~~~Id~~~~ieeV~~~I~~ii~~~  192 (194)
T d1qf9a_         164 NKFDKVKIIPANRDVNEVYNDVENLFKSM  192 (194)
T ss_dssp             HHTTCEEEEECSSCHHHHHHHHHHHHHHT
T ss_pred             HhCCCEEEEECCCCHHHHHHHHHHHHHHc
Confidence            88889999999999999999999988765



>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gg4a4 c.72.2.1 (A:99-312) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ua3 c.72.2.1 (A:89-295) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d2jfga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1p3da3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gc6a2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure