Citrus Sinensis ID: 029293

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----

MSEEPAPKSIPESSSSAVNGGRTIEECQDMIQRSLRNPTVKFLRQHLEKAGCGFGDKFIKAVHCDKKIAGGYVRGEGILVCSNHMNIQDEVNQVIIHELIHAYDECRAANLDWSNCAHHACSEIRAGHLSGDCHYKRELLRGYMKIRGHEQDCVRRRVMKSVIANPYCSAAAAKDAMEAVWDVCYNDTQPFDRAP

cccccccccccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccEEEEEccccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHcHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccc

**********************TIEECQDMIQRSLRNPTVKFLRQHLEKAGCGFGDKFIKAVHCDKKIAGGYVRGEGILVCSNHMNIQDEVNQVIIHELIHAYDECRAANLDWSNCAHHACSEIRAGHLSGDCHYKRELLRGYMKIRGHEQDCVRRRVMKSVIANPYCSAAAAKDAMEAVWDVCYNDTQPFD**P

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSEEPAPKSIPESSSSAVNGGRTIEECQDMIQRSLRNPTVKFLRQHLEKAGCGFGDKFIKAVHCDKKIAGGYVRGEGILVCSNHMNIQDEVNQVIIHELIHAYDECRAANLDWSNCAHHACSEIRAGHLSGDCHYKRELLRGYMKIRGHEQDCVRRRVMKSVIANPYCSAAAAKDAMEAVWDVCYNDTQPFDRAP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mitochondrial inner membrane protease atp23	Has a dual role in the assembly of mitochondrial ATPase. Acts as a protease that removes N-terminal residues of mitochondrial ATPase CF(0) subunit 6 at the intermembrane space side. Also involved in the correct assembly of the membrane-embedded ATPase CF(0) particle, probably mediating association of subunit 6 with the subunit 9 ring.	probable	Q1MTR0
Mitochondrial inner membrane protease ATP23	Has a dual role in the assembly of mitochondrial ATPase. Acts as a protease that removes N-terminal residues of mitochondrial ATPase CF(0) subunit 6 at the intermembrane space side. Also involved in the correct assembly of the membrane-embedded ATPase CF(0) particle, probably mediating association of subunit 6 with the subunit 9 ring.	probable	Q6FIY7
Mitochondrial inner membrane protease ATP23	Has a dual role in the assembly of mitochondrial ATPase. Acts as a protease that removes the N-terminal 10 residues of mitochondrial ATPase CF(0) subunit 6 (ATP6) at the intermembrane space side. Also involved in the correct assembly of the membrane-embedded ATPase CF(0) particle, probably mediating association of ATP6 with the subunit 9 ring.	probable	P53722

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1R1H, chain A
Confidence level:probable
Coverage over the Query: 45-109
View the alignment between query and template
View the model in PyMOL