Citrus Sinensis ID: 029295


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQTLSLRRYR
ccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccEEEcccccccHHHHHHcccccccEEEEEEEEECccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccEEECcc
*GAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRP*P*GIVYGK**********FQRSKRSVAEERAGRKLGGLKDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTS************************TWKRNQTLS*RRYR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQTLSLRRYR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L15-2 confidentQ8VYF1
60S ribosomal protein L15-1 confidentO23515
60S ribosomal protein L15 probableP91374

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A17, chain L
Confidence level:very confident
Coverage over the Query: 2-195
View the alignment between query and template
View the model in PyMOL