Citrus Sinensis ID: 029304


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MSPNGSQHSPHPLITATSAACNSNRSNSSSNNNNNVIIPDVHELRQVFNKFDANGDGKISASELGSILTSLGHAATEEELQKMVREIDADGDGFVDFDEFVELNTKGVDSAEVMENLKDAFSVYDIDGNGSITAEELHQVLRSLGDDCTLAECRRMIRGVDCDGDGTIDFEEFKVMMTAGSRYEFADPVQGQVAV
cccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHccccccCEcHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHccccccccccHHHHHHHHcccccccccHHHHccccc
****************************************VHELRQVFNKFDANGDGKISASELGSILTSLGHAATEEELQKMVREIDADGDGFVDFDEFVELNTKGVDSAEVMENLKDAFSVYDIDGNGSITAEELHQVLRSLGDDCTLAECRRMIRGVDCDGDGTIDFEEFKVMMTA**********QGQVA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPNGSQHSPHPLITATSAACNSNRSNSSSNNNNNVIIPDVHELRQVFNKFDANGDGKISASELGSILTSLGHAATEEELQKMVREIDADGDGFVDFDEFVELNTKGVDSAEVMENLKDAFSVYDIDGNGSITAEELHQVLRSLGDDCTLAECRRMIRGVDCDGDGTIDFEEFKVMMTAGSRYEFADPVQGQVAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable calcium-binding protein CML25 Potential calcium sensor.probableQ9FYK2
Probable calcium-binding protein CML10 Potential calcium sensor.probableQ8RZB5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F2O, chain A
Confidence level:very confident
Coverage over the Query: 37-179
View the alignment between query and template
View the model in PyMOL
Template: 3PM8, chain A
Confidence level:very confident
Coverage over the Query: 19-180
View the alignment between query and template
View the model in PyMOL