Citrus Sinensis ID: 029304
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 195 | ||||||
| 449523998 | 182 | PREDICTED: probable calcium-binding prot | 0.738 | 0.791 | 0.756 | 4e-59 | |
| 449465808 | 164 | PREDICTED: probable calcium-binding prot | 0.728 | 0.865 | 0.767 | 1e-58 | |
| 255570063 | 190 | Polcalcin Jun o, putative [Ricinus commu | 0.748 | 0.768 | 0.726 | 2e-58 | |
| 356511295 | 188 | PREDICTED: probable calcium-binding prot | 0.758 | 0.787 | 0.743 | 1e-57 | |
| 224108279 | 149 | predicted protein [Populus trichocarpa] | 0.748 | 0.979 | 0.705 | 9e-57 | |
| 15221781 | 186 | putative calcium-binding protein CML25 [ | 0.712 | 0.747 | 0.727 | 1e-56 | |
| 297845638 | 192 | hypothetical protein ARALYDRAFT_335836 [ | 0.733 | 0.744 | 0.720 | 8e-56 | |
| 224101885 | 149 | predicted protein [Populus trichocarpa] | 0.738 | 0.966 | 0.715 | 3e-55 | |
| 71040671 | 164 | calcium-binding pollen allergen [Arachis | 0.753 | 0.896 | 0.707 | 4e-55 | |
| 449449242 | 185 | PREDICTED: probable calcium-binding prot | 0.707 | 0.745 | 0.707 | 1e-52 |
| >gi|449523998|ref|XP_004169010.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 233 bits (593), Expect = 4e-59, Method: Compositional matrix adjust.
Identities = 109/144 (75%), Positives = 128/144 (88%)
Query: 41 VHELRQVFNKFDANGDGKISASELGSILTSLGHAATEEELQKMVREIDADGDGFVDFDEF 100
+ EL QVFNKFD NGDGKI +SELGSI+ SLG ATEEELQ M++E+DADGDG++D DEF
Sbjct: 35 IAELEQVFNKFDVNGDGKICSSELGSIMGSLGQPATEEELQNMIKEVDADGDGYIDLDEF 94
Query: 101 VELNTKGVDSAEVMENLKDAFSVYDIDGNGSITAEELHQVLRSLGDDCTLAECRRMIRGV 160
+ELNTKGVDS EV+ENLKDAFSVYDIDGNGSITAEELH+VL+SLGDDC+LA+CR+MI GV
Sbjct: 95 IELNTKGVDSDEVLENLKDAFSVYDIDGNGSITAEELHEVLKSLGDDCSLADCRKMITGV 154
Query: 161 DCDGDGTIDFEEFKVMMTAGSRYE 184
D +GDG I F+EFKVMM +GSR +
Sbjct: 155 DKNGDGMISFDEFKVMMMSGSRSQ 178
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449465808|ref|XP_004150619.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255570063|ref|XP_002525994.1| Polcalcin Jun o, putative [Ricinus communis] gi|223534726|gb|EEF36418.1| Polcalcin Jun o, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356511295|ref|XP_003524362.1| PREDICTED: probable calcium-binding protein CML25-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224108279|ref|XP_002314786.1| predicted protein [Populus trichocarpa] gi|222863826|gb|EEF00957.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|15221781|ref|NP_173866.1| putative calcium-binding protein CML25 [Arabidopsis thaliana] gi|75334522|sp|Q9FYK2.1|CML25_ARATH RecName: Full=Probable calcium-binding protein CML25; AltName: Full=Calmodulin-like protein 25 gi|9743349|gb|AAF97973.1|AC000103_23 F21J9.28 [Arabidopsis thaliana] gi|91805849|gb|ABE65653.1| polcalcin [Arabidopsis thaliana] gi|332192433|gb|AEE30554.1| putative calcium-binding protein CML25 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297845638|ref|XP_002890700.1| hypothetical protein ARALYDRAFT_335836 [Arabidopsis lyrata subsp. lyrata] gi|297336542|gb|EFH66959.1| hypothetical protein ARALYDRAFT_335836 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|224101885|ref|XP_002312460.1| predicted protein [Populus trichocarpa] gi|222852280|gb|EEE89827.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|71040671|gb|AAZ20284.1| calcium-binding pollen allergen [Arachis hypogaea] | Back alignment and taxonomy information |
|---|
| >gi|449449242|ref|XP_004142374.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 195 | ||||||
| TAIR|locus:2024046 | 186 | AT1G24620 [Arabidopsis thalian | 0.733 | 0.768 | 0.671 | 2.9e-48 | |
| TAIR|locus:2194105 | 170 | AT1G18210 [Arabidopsis thalian | 0.692 | 0.794 | 0.453 | 5e-28 | |
| TAIR|locus:2027869 | 163 | AT1G73630 [Arabidopsis thalian | 0.682 | 0.815 | 0.445 | 2.5e-26 | |
| TAIR|locus:2156040 | 161 | TCH2 "TOUCH 2" [Arabidopsis th | 0.707 | 0.857 | 0.394 | 3.2e-26 | |
| TAIR|locus:2201542 | 157 | CML23 "calmodulin like 23" [Ar | 0.723 | 0.898 | 0.409 | 5.2e-26 | |
| UNIPROTKB|F2Z4K8 | 148 | CALM "Uncharacterized protein" | 0.712 | 0.939 | 0.402 | 2e-24 | |
| UNIPROTKB|P62149 | 149 | CALM "Calmodulin" [Gallus gall | 0.712 | 0.932 | 0.402 | 2e-24 | |
| UNIPROTKB|F1N6C0 | 150 | F1N6C0 "Uncharacterized protei | 0.712 | 0.926 | 0.402 | 2e-24 | |
| UNIPROTKB|P62157 | 149 | CALM "Calmodulin" [Bos taurus | 0.712 | 0.932 | 0.402 | 2e-24 | |
| UNIPROTKB|E2REK6 | 149 | CALM1 "Uncharacterized protein | 0.712 | 0.932 | 0.402 | 2e-24 |
| TAIR|locus:2024046 AT1G24620 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 504 (182.5 bits), Expect = 2.9e-48, P = 2.9e-48
Identities = 96/143 (67%), Positives = 113/143 (79%)
Query: 40 DVHELRQVFNKFDANGDGKISASELGSILTSLGHAATEEELQKMVREIDAXXXXXXXXXX 99
++ EL VF KFD NGDGKIS+ ELG+I+TSLGH EEEL+K + EID
Sbjct: 34 EIRELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVPEEELEKAITEIDRKGDGYINFEE 93
Query: 100 XXXLNTKGVDSAEVMENLKDAFSVYDIDGNGSITAEELHQVLRSLGDDCTLAECRRMIRG 159
LNTKG+D +V+ENLKDAFSVYDIDGNGSI+AEELH+VLRSLGD+C++AECR+MI G
Sbjct: 94 FVELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDECSIAECRKMIGG 153
Query: 160 VDCDGDGTIDFEEFKVMMTAGSR 182
VD DGDGTIDFEEFK+MMT GSR
Sbjct: 154 VDKDGDGTIDFEEFKIMMTMGSR 176
|
|
| TAIR|locus:2194105 AT1G18210 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2027869 AT1G73630 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156040 TCH2 "TOUCH 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201542 CML23 "calmodulin like 23" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z4K8 CALM "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P62149 CALM "Calmodulin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N6C0 F1N6C0 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P62157 CALM "Calmodulin" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2REK6 CALM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| AT1G24620 | polcalcin, putative / calcium-binding pollen allergen, putative; polcalcin, putative / calcium-binding pollen allergen, putative; FUNCTIONS IN- calcium ion binding; INVOLVED IN- response to cold; LOCATED IN- nucleus; EXPRESSED IN- 7 plant structures; EXPRESSED DURING- L mature pollen stage, M germinated pollen stage, 4 anthesis, petal differentiation and expansion stage; CONTAINS InterPro DOMAIN/s- EF-HAND 1 (InterPro-IPR018247), EF-HAND 2 (InterPro-IPR018249), EF-Hand type (InterPro-IPR011992), Calcium-binding EF-hand (InterPro-IPR002048), EF hand (InterPro-IPR018248); BEST Arabidopsi [...] (186 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| AT3G10300 | • | 0.823 | |||||||||
| NOA1 | • | 0.800 | |||||||||
| CHX26 | • | 0.508 | |||||||||
| APC1 | • | • | 0.446 | ||||||||
| CHX12 | • | 0.439 | |||||||||
| ATCHX7 | • | 0.408 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 195 | |||
| PTZ00184 | 149 | PTZ00184, PTZ00184, calmodulin; Provisional | 8e-39 | |
| COG5126 | 160 | COG5126, FRQ1, Ca2+-binding protein (EF-Hand super | 4e-34 | |
| PTZ00183 | 158 | PTZ00183, PTZ00183, centrin; Provisional | 8e-31 | |
| cd00051 | 63 | cd00051, EFh, EF-hand, calcium binding motif; A di | 5e-22 | |
| cd00051 | 63 | cd00051, EFh, EF-hand, calcium binding motif; A di | 1e-20 | |
| PTZ00184 | 149 | PTZ00184, PTZ00184, calmodulin; Provisional | 8e-17 | |
| PTZ00183 | 158 | PTZ00183, PTZ00183, centrin; Provisional | 2e-12 | |
| pfam13833 | 53 | pfam13833, EF_hand_6, EF-hand domain pair | 2e-12 | |
| pfam13499 | 60 | pfam13499, EF_hand_5, EF-hand domain pair | 7e-11 | |
| PTZ00183 | 158 | PTZ00183, PTZ00183, centrin; Provisional | 8e-11 | |
| pfam13833 | 53 | pfam13833, EF_hand_6, EF-hand domain pair | 5e-09 | |
| pfam13499 | 60 | pfam13499, EF_hand_5, EF-hand domain pair | 2e-08 | |
| cd00052 | 67 | cd00052, EH, Eps15 homology domain; found in prote | 2e-07 | |
| pfam13405 | 30 | pfam13405, EF_hand_4, EF-hand domain | 1e-06 | |
| pfam13405 | 30 | pfam13405, EF_hand_4, EF-hand domain | 3e-06 | |
| smart00054 | 29 | smart00054, EFh, EF-hand, calcium binding motif | 3e-06 | |
| pfam13499 | 60 | pfam13499, EF_hand_5, EF-hand domain pair | 4e-06 | |
| pfam00036 | 29 | pfam00036, efhand, EF hand | 7e-06 | |
| pfam00036 | 29 | pfam00036, efhand, EF hand | 2e-05 | |
| pfam13202 | 25 | pfam13202, EF_hand_3, EF hand | 2e-05 | |
| pfam00036 | 29 | pfam00036, efhand, EF hand | 3e-05 | |
| smart00054 | 29 | smart00054, EFh, EF-hand, calcium binding motif | 4e-05 | |
| smart00054 | 29 | smart00054, EFh, EF-hand, calcium binding motif | 4e-05 | |
| smart00054 | 29 | smart00054, EFh, EF-hand, calcium binding motif | 1e-04 | |
| smart00027 | 96 | smart00027, EH, Eps15 homology domain | 2e-04 | |
| pfam00036 | 29 | pfam00036, efhand, EF hand | 4e-04 | |
| PLN02964 | 644 | PLN02964, PLN02964, phosphatidylserine decarboxyla | 4e-04 | |
| pfam13202 | 25 | pfam13202, EF_hand_3, EF hand | 0.002 | |
| cd00213 | 88 | cd00213, S-100, S-100: S-100 domain, which represe | 0.002 | |
| pfam13202 | 25 | pfam13202, EF_hand_3, EF hand | 0.003 |
| >gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional | Back alignment and domain information |
|---|
Score = 129 bits (327), Expect = 8e-39
Identities = 64/140 (45%), Positives = 91/140 (65%)
Query: 40 DVHELRQVFNKFDANGDGKISASELGSILTSLGHAATEEELQKMVREIDADGDGFVDFDE 99
+ E ++ F+ FD +GDG I+ ELG+++ SLG TE ELQ M+ E+DADG+G +DF E
Sbjct: 9 QIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 68
Query: 100 FVELNTKGVDSAEVMENLKDAFSVYDIDGNGSITAEELHQVLRSLGDDCTLAECRRMIRG 159
F+ L + + + E +K+AF V+D DGNG I+A EL V+ +LG+ T E MIR
Sbjct: 69 FLTLMARKMKDTDSEEEIKEAFKVFDRDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 128
Query: 160 VDCDGDGTIDFEEFKVMMTA 179
D DGDG I++EEF MM +
Sbjct: 129 ADVDGDGQINYEEFVKMMMS 148
|
Length = 149 |
| >gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|238009 cd00052, EH, Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >gnl|CDD|205583 pfam13405, EF_hand_4, EF-hand domain | Back alignment and domain information |
|---|
| >gnl|CDD|205583 pfam13405, EF_hand_4, EF-hand domain | Back alignment and domain information |
|---|
| >gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|200946 pfam00036, efhand, EF hand | Back alignment and domain information |
|---|
| >gnl|CDD|200946 pfam00036, efhand, EF hand | Back alignment and domain information |
|---|
| >gnl|CDD|205383 pfam13202, EF_hand_3, EF hand | Back alignment and domain information |
|---|
| >gnl|CDD|200946 pfam00036, efhand, EF hand | Back alignment and domain information |
|---|
| >gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|197477 smart00027, EH, Eps15 homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|200946 pfam00036, efhand, EF hand | Back alignment and domain information |
|---|
| >gnl|CDD|215520 PLN02964, PLN02964, phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|205383 pfam13202, EF_hand_3, EF hand | Back alignment and domain information |
|---|
| >gnl|CDD|238131 cd00213, S-100, S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >gnl|CDD|205383 pfam13202, EF_hand_3, EF hand | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 195 | |||
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 99.97 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 99.94 | |
| PTZ00183 | 158 | centrin; Provisional | 99.93 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 99.91 | |
| PTZ00184 | 149 | calmodulin; Provisional | 99.91 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 99.9 | |
| KOG0030 | 152 | consensus Myosin essential light chain, EF-Hand pr | 99.83 | |
| KOG0037 | 221 | consensus Ca2+-binding protein, EF-Hand protein su | 99.83 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 99.83 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 99.77 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 99.76 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 99.5 | |
| KOG0037 | 221 | consensus Ca2+-binding protein, EF-Hand protein su | 99.45 | |
| KOG4223 | 325 | consensus Reticulocalbin, calumenin, DNA supercoil | 99.41 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 99.39 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 99.37 | |
| KOG0038 | 189 | consensus Ca2+-binding kinase interacting protein | 99.36 | |
| KOG4223 | 325 | consensus Reticulocalbin, calumenin, DNA supercoil | 99.33 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 99.33 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 99.31 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 99.31 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 99.28 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 99.28 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 99.28 | |
| PTZ00183 | 158 | centrin; Provisional | 99.27 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 99.23 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 99.21 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 99.21 | |
| PTZ00184 | 149 | calmodulin; Provisional | 99.2 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 99.2 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 99.16 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 99.16 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 99.16 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 99.16 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 99.14 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 99.13 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 99.11 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 99.1 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 99.09 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 99.08 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 99.07 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 99.07 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 99.06 | |
| KOG2643 | 489 | consensus Ca2+ binding protein, contains EF-hand m | 99.06 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 99.06 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 99.05 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 99.04 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 99.04 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 99.03 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 99.03 | |
| KOG2562 | 493 | consensus Protein phosphatase 2 regulatory subunit | 99.01 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 98.98 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 98.94 | |
| PF14658 | 66 | EF-hand_9: EF-hand domain | 98.93 | |
| KOG0040 | 2399 | consensus Ca2+-binding actin-bundling protein (spe | 98.91 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 98.9 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 98.87 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 98.82 | |
| PF14658 | 66 | EF-hand_9: EF-hand domain | 98.82 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 98.81 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 98.75 | |
| KOG4251 | 362 | consensus Calcium binding protein [General functio | 98.72 | |
| KOG0041 | 244 | consensus Predicted Ca2+-binding protein, EF-Hand | 98.72 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 98.68 | |
| KOG0041 | 244 | consensus Predicted Ca2+-binding protein, EF-Hand | 98.65 | |
| KOG2643 | 489 | consensus Ca2+ binding protein, contains EF-hand m | 98.56 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 98.52 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 98.47 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 98.45 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 98.43 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 98.41 | |
| KOG0751 | 694 | consensus Mitochondrial aspartate/glutamate carrie | 98.38 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 98.35 | |
| KOG0169 | 746 | consensus Phosphoinositide-specific phospholipase | 98.35 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 98.31 | |
| KOG4666 | 412 | consensus Predicted phosphate acyltransferase, con | 98.29 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 98.24 | |
| KOG0030 | 152 | consensus Myosin essential light chain, EF-Hand pr | 98.2 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 98.18 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 98.18 | |
| KOG0751 | 694 | consensus Mitochondrial aspartate/glutamate carrie | 98.14 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 98.11 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 98.05 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 98.02 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 97.98 | |
| KOG2562 | 493 | consensus Protein phosphatase 2 regulatory subunit | 97.9 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 97.89 | |
| KOG0046 | 627 | consensus Ca2+-binding actin-bundling protein (fim | 97.88 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 97.87 | |
| KOG0038 | 189 | consensus Ca2+-binding kinase interacting protein | 97.84 | |
| PF10591 | 113 | SPARC_Ca_bdg: Secreted protein acidic and rich in | 97.75 | |
| KOG1707 | 625 | consensus Predicted Ras related/Rac-GTP binding pr | 97.71 | |
| KOG0040 | 2399 | consensus Ca2+-binding actin-bundling protein (spe | 97.64 | |
| PF09279 | 83 | EF-hand_like: Phosphoinositide-specific phospholip | 97.63 | |
| PF10591 | 113 | SPARC_Ca_bdg: Secreted protein acidic and rich in | 97.62 | |
| KOG4666 | 412 | consensus Predicted phosphate acyltransferase, con | 97.55 | |
| KOG0998 | 847 | consensus Synaptic vesicle protein EHS-1 and relat | 97.36 | |
| KOG0046 | 627 | consensus Ca2+-binding actin-bundling protein (fim | 97.23 | |
| KOG0035 | 890 | consensus Ca2+-binding actin-bundling protein (act | 97.17 | |
| smart00054 | 29 | EFh EF-hand, calcium binding motif. EF-hands are c | 97.08 | |
| KOG1955 | 737 | consensus Ral-GTPase effector RALBP1 [Intracellula | 97.07 | |
| KOG4065 | 144 | consensus Uncharacterized conserved protein [Funct | 97.05 | |
| smart00054 | 29 | EFh EF-hand, calcium binding motif. EF-hands are c | 96.98 | |
| KOG4065 | 144 | consensus Uncharacterized conserved protein [Funct | 96.83 | |
| PF09279 | 83 | EF-hand_like: Phosphoinositide-specific phospholip | 96.76 | |
| KOG4251 | 362 | consensus Calcium binding protein [General functio | 96.68 | |
| PF05042 | 174 | Caleosin: Caleosin related protein; InterPro: IPR0 | 96.58 | |
| KOG0042 | 680 | consensus Glycerol-3-phosphate dehydrogenase [Ener | 96.22 | |
| KOG3555 | 434 | consensus Ca2+-binding proteoglycan Testican [Gene | 96.07 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 96.04 | |
| KOG1265 | 1189 | consensus Phospholipase C [Lipid transport and met | 96.04 | |
| KOG3555 | 434 | consensus Ca2+-binding proteoglycan Testican [Gene | 95.71 | |
| KOG1955 | 737 | consensus Ral-GTPase effector RALBP1 [Intracellula | 95.67 | |
| PF09069 | 90 | EF-hand_3: EF-hand; InterPro: IPR015154 Like other | 95.55 | |
| PF05517 | 154 | p25-alpha: p25-alpha ; InterPro: IPR008907 This fa | 95.43 | |
| KOG4347 | 671 | consensus GTPase-activating protein VRP [General f | 95.29 | |
| PF05042 | 174 | Caleosin: Caleosin related protein; InterPro: IPR0 | 95.17 | |
| KOG0042 | 680 | consensus Glycerol-3-phosphate dehydrogenase [Ener | 94.83 | |
| KOG0169 | 746 | consensus Phosphoinositide-specific phospholipase | 94.76 | |
| PF05517 | 154 | p25-alpha: p25-alpha ; InterPro: IPR008907 This fa | 94.75 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 94.17 | |
| KOG2243 | 5019 | consensus Ca2+ release channel (ryanodine receptor | 93.83 | |
| KOG1264 | 1267 | consensus Phospholipase C [Lipid transport and met | 93.75 | |
| KOG4347 | 671 | consensus GTPase-activating protein VRP [General f | 93.62 | |
| KOG4578 | 421 | consensus Uncharacterized conserved protein, conta | 93.45 | |
| KOG4578 | 421 | consensus Uncharacterized conserved protein, conta | 93.28 | |
| KOG3866 | 442 | consensus DNA-binding protein of the nucleobindin | 92.93 | |
| PF08726 | 69 | EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr | 92.75 | |
| KOG0998 | 847 | consensus Synaptic vesicle protein EHS-1 and relat | 92.55 | |
| KOG2243 | 5019 | consensus Ca2+ release channel (ryanodine receptor | 92.34 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 91.89 | |
| cd07313 | 104 | terB_like_2 tellurium resistance terB-like protein | 91.57 | |
| PF08976 | 118 | DUF1880: Domain of unknown function (DUF1880); Int | 91.24 | |
| PF08414 | 100 | NADPH_Ox: Respiratory burst NADPH oxidase; InterPr | 89.89 | |
| PF08726 | 69 | EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr | 87.99 | |
| PF08976 | 118 | DUF1880: Domain of unknown function (DUF1880); Int | 87.79 | |
| PLN02222 | 581 | phosphoinositide phospholipase C 2 | 87.23 | |
| COG4103 | 148 | Uncharacterized protein conserved in bacteria [Fun | 86.43 | |
| KOG0035 | 890 | consensus Ca2+-binding actin-bundling protein (act | 86.36 | |
| PLN02230 | 598 | phosphoinositide phospholipase C 4 | 85.54 | |
| KOG4286 | 966 | consensus Dystrophin-like protein [Cell motility; | 85.53 | |
| KOG3866 | 442 | consensus DNA-binding protein of the nucleobindin | 85.38 | |
| PLN02228 | 567 | Phosphoinositide phospholipase C | 85.34 | |
| KOG1707 | 625 | consensus Predicted Ras related/Rac-GTP binding pr | 84.52 |
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
Probab=99.97 E-value=1e-28 Score=167.60 Aligned_cols=151 Identities=37% Similarity=0.648 Sum_probs=143.6
Q ss_pred CCCCCCCChHhHHHHHHHhhhhcCCCCCcccHHHHHHHHHHcCCCCCHHHHHHHHHHHccCCCCceeHHHHHHHHhhcCC
Q 029304 30 SNNNNNVIIPDVHELRQVFNKFDANGDGKISASELGSILTSLGHAATEEELQKMVREIDADGDGFVDFDEFVELNTKGVD 109 (195)
Q Consensus 30 ~~~~~~l~~~~~~~~~~~F~~~d~~~~g~l~~~e~~~~l~~~~~~~~~~~~~~l~~~~d~~~~~~i~~~eF~~~~~~~~~ 109 (195)
......+++++++++++.|..+|++++|.|+.++|..+++.+|...+..++.+++..++. +.+.|+|.+|+.++.....
T Consensus 8 ~~~~~~~t~~qi~~lkeaF~l~D~d~~G~I~~~el~~ilr~lg~~~s~~ei~~l~~~~d~-~~~~idf~~Fl~~ms~~~~ 86 (160)
T COG5126 8 LLTFTQLTEEQIQELKEAFQLFDRDSDGLIDRNELGKILRSLGFNPSEAEINKLFEEIDA-GNETVDFPEFLTVMSVKLK 86 (160)
T ss_pred hhhcccCCHHHHHHHHHHHHHhCcCCCCCCcHHHHHHHHHHcCCCCcHHHHHHHHHhccC-CCCccCHHHHHHHHHHHhc
Confidence 455779999999999999999999999999999999999999999999999999999998 8899999999999999887
Q ss_pred cHHHHHHHHHHHHhhcCCCCCcccHHHHHHHHHHhCCCCCHHHHHHHHHhhcCCCCcceeHHHHHHHHHcCC
Q 029304 110 SAEVMENLKDAFSVYDIDGNGSITAEELHQVLRSLGDDCTLAECRRMIRGVDCDGDGTIDFEEFKVMMTAGS 181 (195)
Q Consensus 110 ~~~~~~~~~~~f~~~D~~~~g~i~~~e~~~~l~~~~~~~~~~~~~~~~~~~d~~~~g~i~~~eF~~~l~~~~ 181 (195)
.....+.+..+|+.||++++|+|+..+++.++..+|..+++++++.++..++.+++|.|+|++|+..+...+
T Consensus 87 ~~~~~Eel~~aF~~fD~d~dG~Is~~eL~~vl~~lge~~~deev~~ll~~~d~d~dG~i~~~eF~~~~~~~~ 158 (160)
T COG5126 87 RGDKEEELREAFKLFDKDHDGYISIGELRRVLKSLGERLSDEEVEKLLKEYDEDGDGEIDYEEFKKLIKDSP 158 (160)
T ss_pred cCCcHHHHHHHHHHhCCCCCceecHHHHHHHHHhhcccCCHHHHHHHHHhcCCCCCceEeHHHHHHHHhccC
Confidence 777788999999999999999999999999999999999999999999999999999999999999877643
|
|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >KOG4251 consensus Calcium binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins | Back alignment and domain information |
|---|
| >KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C | Back alignment and domain information |
|---|
| >PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins | Back alignment and domain information |
|---|
| >KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0998 consensus Synaptic vesicle protein EHS-1 and related EH domain proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0035 consensus Ca2+-binding actin-bundling protein (actinin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00054 EFh EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4065 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00054 EFh EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >KOG4065 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C | Back alignment and domain information |
|---|
| >KOG4251 consensus Calcium binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin | Back alignment and domain information |
|---|
| >KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG1265 consensus Phospholipase C [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions | Back alignment and domain information |
|---|
| >PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] | Back alignment and domain information |
|---|
| >KOG4347 consensus GTPase-activating protein VRP [General function prediction only] | Back alignment and domain information |
|---|
| >PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin | Back alignment and domain information |
|---|
| >KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1264 consensus Phospholipase C [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4347 consensus GTPase-activating protein VRP [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only] | Back alignment and domain information |
|---|
| >PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes | Back alignment and domain information |
|---|
| >KOG0998 consensus Synaptic vesicle protein EHS-1 and related EH domain proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >cd07313 terB_like_2 tellurium resistance terB-like protein, subgroup 2 | Back alignment and domain information |
|---|
| >PF08976 DUF1880: Domain of unknown function (DUF1880); InterPro: IPR015070 This entry represents EF-hand calcium-binding domain-containing protein 6 that negatively regulates the androgen receptor by recruiting histone deacetylase complex, and protein DJ-1 antagonises this inhibition by abrogation of this complex [] | Back alignment and domain information |
|---|
| >PF08414 NADPH_Ox: Respiratory burst NADPH oxidase; InterPro: IPR013623 This domain is found in plant proteins such as respiratory burst NADPH oxidase proteins which produce reactive oxygen species as a defence mechanism | Back alignment and domain information |
|---|
| >PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes | Back alignment and domain information |
|---|
| >PF08976 DUF1880: Domain of unknown function (DUF1880); InterPro: IPR015070 This entry represents EF-hand calcium-binding domain-containing protein 6 that negatively regulates the androgen receptor by recruiting histone deacetylase complex, and protein DJ-1 antagonises this inhibition by abrogation of this complex [] | Back alignment and domain information |
|---|
| >PLN02222 phosphoinositide phospholipase C 2 | Back alignment and domain information |
|---|
| >COG4103 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0035 consensus Ca2+-binding actin-bundling protein (actinin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN02230 phosphoinositide phospholipase C 4 | Back alignment and domain information |
|---|
| >KOG4286 consensus Dystrophin-like protein [Cell motility; Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02228 Phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 195 | ||||
| 1xfu_O | 149 | Crystal Structure Of Anthrax Edema Factor (ef) Trun | 2e-25 | ||
| 1xfu_O | 149 | Crystal Structure Of Anthrax Edema Factor (ef) Trun | 1e-13 | ||
| 3ekh_A | 449 | Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER | 2e-25 | ||
| 3ekh_A | 449 | Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER | 2e-14 | ||
| 3o77_A | 415 | The Structure Of Ca2+ Sensor (Case-16) Length = 415 | 2e-25 | ||
| 3o77_A | 415 | The Structure Of Ca2+ Sensor (Case-16) Length = 415 | 6e-14 | ||
| 2lv6_A | 148 | The Complex Between Ca-calmodulin And Skeletal Musc | 2e-25 | ||
| 2lv6_A | 148 | The Complex Between Ca-calmodulin And Skeletal Musc | 1e-13 | ||
| 3ek8_A | 449 | Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER L | 2e-25 | ||
| 3ek8_A | 449 | Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER L | 2e-14 | ||
| 3sg6_A | 450 | Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) L | 2e-25 | ||
| 3sg6_A | 450 | Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) L | 2e-14 | ||
| 3evr_A | 411 | Crystal Structure Of Calcium Bound Monomeric Gcamp2 | 2e-25 | ||
| 3evr_A | 411 | Crystal Structure Of Calcium Bound Monomeric Gcamp2 | 3e-14 | ||
| 3o78_A | 415 | The Structure Of Ca2+ Sensor (Case-12) Length = 415 | 2e-25 | ||
| 3o78_A | 415 | The Structure Of Ca2+ Sensor (Case-12) Length = 415 | 2e-14 | ||
| 3evu_A | 449 | Crystal Structure Of Calcium Bound Dimeric Gcamp2, | 2e-25 | ||
| 3evu_A | 449 | Crystal Structure Of Calcium Bound Dimeric Gcamp2, | 2e-14 | ||
| 3sg5_A | 448 | Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linke | 2e-25 | ||
| 3sg5_A | 448 | Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linke | 5e-15 | ||
| 3sg2_A | 449 | Crystal Structure Of Gcamp2-T116v,D381y Length = 44 | 2e-25 | ||
| 3sg2_A | 449 | Crystal Structure Of Gcamp2-T116v,D381y Length = 44 | 6e-15 | ||
| 3ewt_A | 154 | Crystal Structure Of Calmodulin Complexed With A Pe | 2e-25 | ||
| 3ewt_A | 154 | Crystal Structure Of Calmodulin Complexed With A Pe | 1e-13 | ||
| 1cm1_A | 148 | Motions Of Calmodulin-Single-Conformer Refinement L | 2e-25 | ||
| 1cm1_A | 148 | Motions Of Calmodulin-Single-Conformer Refinement L | 1e-13 | ||
| 4djc_A | 152 | 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCA | 2e-25 | ||
| 4djc_A | 152 | 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCA | 1e-13 | ||
| 1y0v_H | 146 | Crystal Structure Of Anthrax Edema Factor (Ef) In C | 3e-25 | ||
| 1y0v_H | 146 | Crystal Structure Of Anthrax Edema Factor (Ef) In C | 1e-13 | ||
| 3sg4_A | 448 | Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Len | 3e-25 | ||
| 3sg4_A | 448 | Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Len | 5e-15 | ||
| 3sg3_A | 449 | Crystal Structure Of Gcamp3-D380y Length = 449 | 3e-25 | ||
| 3sg3_A | 449 | Crystal Structure Of Gcamp3-D380y Length = 449 | 2e-15 | ||
| 1k93_D | 144 | Crystal Structure Of The Adenylyl Cyclase Domain Of | 3e-25 | ||
| 1k93_D | 144 | Crystal Structure Of The Adenylyl Cyclase Domain Of | 1e-13 | ||
| 3sg7_A | 448 | Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 4 | 3e-25 | ||
| 3sg7_A | 448 | Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 4 | 8e-15 | ||
| 2wel_D | 150 | Crystal Structure Of Su6656-Bound CalciumCALMODULIN | 3e-25 | ||
| 2wel_D | 150 | Crystal Structure Of Su6656-Bound CalciumCALMODULIN | 1e-13 | ||
| 1iq5_A | 149 | CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE | 3e-25 | ||
| 1iq5_A | 149 | CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE | 1e-13 | ||
| 1cdl_A | 147 | Target Enzyme Recognition By Calmodulin: 2.4 Angstr | 3e-25 | ||
| 1cdl_A | 147 | Target Enzyme Recognition By Calmodulin: 2.4 Angstr | 1e-13 | ||
| 1cdm_A | 144 | Modulation Of Calmodulin Plasticity In Molecular Re | 3e-25 | ||
| 1cdm_A | 144 | Modulation Of Calmodulin Plasticity In Molecular Re | 1e-13 | ||
| 2ygg_B | 150 | Complex Of Cambr And Cam Length = 150 | 3e-25 | ||
| 2ygg_B | 150 | Complex Of Cambr And Cam Length = 150 | 1e-13 | ||
| 2f2o_A | 179 | Structure Of Calmodulin Bound To A Calcineurin Pept | 3e-25 | ||
| 2f2o_A | 179 | Structure Of Calmodulin Bound To A Calcineurin Pept | 1e-13 | ||
| 2vay_A | 146 | Calmodulin Complexed With Cav1.1 Iq Peptide Length | 3e-25 | ||
| 2vay_A | 146 | Calmodulin Complexed With Cav1.1 Iq Peptide Length | 1e-13 | ||
| 1prw_A | 149 | Crystal Structure Of Bovine Brain Ca++ Calmodulin I | 3e-25 | ||
| 1prw_A | 149 | Crystal Structure Of Bovine Brain Ca++ Calmodulin I | 1e-13 | ||
| 1up5_B | 148 | Chicken Calmodulin Length = 148 | 3e-25 | ||
| 1up5_B | 148 | Chicken Calmodulin Length = 148 | 1e-13 | ||
| 2k0j_A | 148 | Solution Structure Of Cam Complexed To Drp1p Length | 3e-25 | ||
| 2k0j_A | 148 | Solution Structure Of Cam Complexed To Drp1p Length | 3e-14 | ||
| 2be6_A | 150 | 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaC | 3e-25 | ||
| 2be6_A | 150 | 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaC | 1e-13 | ||
| 3u0k_A | 440 | Crystal Structure Of The Genetically Encoded Calciu | 3e-25 | ||
| 3u0k_A | 440 | Crystal Structure Of The Genetically Encoded Calciu | 1e-14 | ||
| 2bbm_A | 148 | Solution Structure Of A Calmodulin-Target Peptide C | 4e-25 | ||
| 2bbm_A | 148 | Solution Structure Of A Calmodulin-Target Peptide C | 1e-13 | ||
| 2bkh_B | 149 | Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc | 5e-25 | ||
| 2bkh_B | 149 | Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc | 1e-13 | ||
| 1ooj_A | 149 | Structural Genomics Of Caenorhabditis Elegans : Cal | 7e-25 | ||
| 1ooj_A | 149 | Structural Genomics Of Caenorhabditis Elegans : Cal | 1e-13 | ||
| 2vb6_B | 149 | Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigo | 7e-25 | ||
| 2vb6_B | 149 | Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigo | 1e-13 | ||
| 1vrk_A | 148 | The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 | 7e-25 | ||
| 1vrk_A | 148 | The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 | 8e-13 | ||
| 1qs7_A | 145 | The 1.8 Angstrom Structure Of Calmodulin Rs20 Pepti | 8e-25 | ||
| 1qtx_A | 148 | The 1.65 Angstrom Structure Of Calmodulin Rs20 Pept | 9e-25 | ||
| 1qtx_A | 148 | The 1.65 Angstrom Structure Of Calmodulin Rs20 Pept | 8e-13 | ||
| 1dmo_A | 148 | Calmodulin, Nmr, 30 Structures Length = 148 | 9e-25 | ||
| 1dmo_A | 148 | Calmodulin, Nmr, 30 Structures Length = 148 | 1e-13 | ||
| 2ix7_A | 145 | Structure Of Apo-Calmodulin Bound To Unconventional | 9e-25 | ||
| 2ix7_A | 145 | Structure Of Apo-Calmodulin Bound To Unconventional | 1e-13 | ||
| 4gow_D | 144 | Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX | 9e-25 | ||
| 4gow_D | 144 | Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX | 1e-13 | ||
| 1ahr_A | 146 | Calmodulin Mutant With A Two Residue Deletion In Th | 1e-24 | ||
| 1ahr_A | 146 | Calmodulin Mutant With A Two Residue Deletion In Th | 1e-13 | ||
| 4aqr_A | 149 | Crystal Structure Of A Calmodulin In Complex With T | 4e-24 | ||
| 1deg_A | 142 | The Linker Of Des-Glu84 Calmodulin Is Bent As Seen | 9e-24 | ||
| 1deg_A | 142 | The Linker Of Des-Glu84 Calmodulin Is Bent As Seen | 1e-13 | ||
| 1rfj_A | 149 | Crystal Structure Of Potato Calmodulin Pcm6 Length | 1e-23 | ||
| 1clm_A | 148 | Structure Of Paramecium Tetraurelia Calmodulin At 1 | 1e-23 | ||
| 1clm_A | 148 | Structure Of Paramecium Tetraurelia Calmodulin At 1 | 1e-12 | ||
| 1exr_A | 148 | The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Ca | 1e-23 | ||
| 1exr_A | 148 | The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Ca | 1e-12 | ||
| 2l1w_A | 149 | The Solution Structure Of Soybean Calmodulin Isofor | 2e-23 | ||
| 2l1w_A | 149 | The Solution Structure Of Soybean Calmodulin Isofor | 6e-11 | ||
| 3ekj_A | 449 | Calcium-Free Gcamp2 (Calcium Binding Deficient Muta | 1e-21 | ||
| 3ekj_A | 449 | Calcium-Free Gcamp2 (Calcium Binding Deficient Muta | 1e-12 | ||
| 1xfx_O | 149 | Crystal Structure Of Anthrax Edema Factor (Ef) In C | 5e-21 | ||
| 1xfx_O | 149 | Crystal Structure Of Anthrax Edema Factor (Ef) In C | 2e-11 | ||
| 1ggz_A | 148 | Crystal Structure Of The Calmodulin-Like Protein (H | 6e-21 | ||
| 1ggz_A | 148 | Crystal Structure Of The Calmodulin-Like Protein (H | 7e-12 | ||
| 1niw_A | 148 | Crystal Structure Of Endothelial Nitric Oxide Synth | 8e-21 | ||
| 1niw_A | 148 | Crystal Structure Of Endothelial Nitric Oxide Synth | 2e-11 | ||
| 1y6w_A | 148 | Trapped Intermediate Of Calmodulin Length = 148 | 6e-20 | ||
| 1y6w_A | 148 | Trapped Intermediate Of Calmodulin Length = 148 | 5e-10 | ||
| 2lmt_A | 148 | Nmr Structure Of Androcam Length = 148 | 5e-19 | ||
| 2lmt_A | 148 | Nmr Structure Of Androcam Length = 148 | 3e-05 | ||
| 2lhi_A | 176 | Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam L | 2e-17 | ||
| 2lhi_A | 176 | Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam L | 4e-09 | ||
| 1lkj_A | 146 | Nmr Structure Of Apo Calmodulin From Yeast Saccharo | 1e-16 | ||
| 1lkj_A | 146 | Nmr Structure Of Apo Calmodulin From Yeast Saccharo | 4e-09 | ||
| 4ds7_A | 147 | Crystal Structure Of Yeast Calmodulin Bound To The | 6e-16 | ||
| 4ds7_A | 147 | Crystal Structure Of Yeast Calmodulin Bound To The | 1e-08 | ||
| 2bl0_B | 145 | Physarum Polycephalum Myosin Ii Regulatory Domain L | 1e-15 | ||
| 5tnc_A | 162 | Refined Crystal Structure Of Troponin C From Turkey | 3e-15 | ||
| 5tnc_A | 162 | Refined Crystal Structure Of Troponin C From Turkey | 8e-11 | ||
| 1tcf_A | 159 | Crystal Structure Of Calcium-Saturated Rabbit Skele | 4e-15 | ||
| 1tcf_A | 159 | Crystal Structure Of Calcium-Saturated Rabbit Skele | 1e-10 | ||
| 1a2x_A | 159 | Complex Of Troponin C With A 47 Residue (1-47) Frag | 4e-15 | ||
| 1a2x_A | 159 | Complex Of Troponin C With A 47 Residue (1-47) Frag | 2e-10 | ||
| 4tnc_A | 162 | Refined Structure Of Chicken Skeletal Muscle Tropon | 5e-15 | ||
| 4tnc_A | 162 | Refined Structure Of Chicken Skeletal Muscle Tropon | 8e-11 | ||
| 3ox6_A | 153 | Crystal Structure Of The Calcium Sensor Calcium-Bin | 5e-15 | ||
| 2obh_A | 143 | Centrin-Xpc Peptide Length = 143 | 6e-15 | ||
| 2obh_A | 143 | Centrin-Xpc Peptide Length = 143 | 5e-07 | ||
| 2lan_A | 167 | Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc | 6e-15 | ||
| 3kf9_A | 149 | Crystal Structure Of The SdcenSKMLCK COMPLEX Length | 6e-15 | ||
| 3kf9_A | 149 | Crystal Structure Of The SdcenSKMLCK COMPLEX Length | 4e-12 | ||
| 3ox5_A | 153 | Crystal Structure Of The Calcium Sensor Calcium-Bin | 7e-15 | ||
| 3qrx_A | 169 | Chlamydomonas Reinhardtii Centrin Bound To Melittin | 7e-15 | ||
| 3qrx_A | 169 | Chlamydomonas Reinhardtii Centrin Bound To Melittin | 2e-12 | ||
| 1sw8_A | 79 | Solution Structure Of The N-Terminal Domain Of Huma | 2e-14 | ||
| 1ytz_C | 162 | Crystal Structure Of Skeletal Muscle Troponin In Th | 2e-14 | ||
| 1ytz_C | 162 | Crystal Structure Of Skeletal Muscle Troponin In Th | 8e-11 | ||
| 2w49_0 | 159 | Isometrically Contracting Insect Asynchronous Fligh | 2e-14 | ||
| 2w49_0 | 159 | Isometrically Contracting Insect Asynchronous Fligh | 8e-11 | ||
| 2i08_A | 78 | Solvation Effect In Conformational Changes Of Ef-Ha | 2e-14 | ||
| 3b32_A | 75 | Crystal Structure Of Calcium-Saturated Calmodulin N | 6e-14 | ||
| 1ak8_A | 76 | Nmr Solution Structure Of Cerium-Loaded Calmodulin | 6e-14 | ||
| 2lqc_A | 77 | Nmr Solution Structure Of A Ca2+-Calmodulin With A | 6e-14 | ||
| 3uct_A | 79 | Structure Of Mn2+-Bound N-Terminal Domain Of Calmod | 6e-14 | ||
| 1f70_A | 76 | Refined Solution Structure Of Calmodulin N-Terminal | 6e-14 | ||
| 1j7o_A | 76 | Solution Structure Of Calcium-calmodulin N-terminal | 6e-14 | ||
| 2llo_A | 80 | Solution Nmr-Derived Structure Of Calmodulin N-Lobe | 7e-14 | ||
| 3ifk_A | 90 | Crystal Structure Of Calcium-Saturated Calmodulin N | 7e-14 | ||
| 1tnw_A | 162 | Nmr Solution Structure Of Calcium Saturated Skeleta | 9e-14 | ||
| 1tnw_A | 162 | Nmr Solution Structure Of Calcium Saturated Skeleta | 8e-11 | ||
| 2jnf_A | 158 | Solution Structure Of Fly Troponin C, Isoform F1 Le | 6e-13 | ||
| 1f71_A | 67 | Refined Solution Structure Of Calmodulin C-Terminal | 1e-12 | ||
| 2ami_A | 96 | Solution Structure Of The Calcium-Loaded N-Terminal | 1e-12 | ||
| 1yru_B | 74 | Crystal Structure Analysis Of The Adenylyl Cyclaes | 1e-12 | ||
| 1cmf_A | 73 | Nmr Solution Structure Of Apo Calmodulin Carboxy-Te | 1e-12 | ||
| 1zot_B | 69 | Crystal Structure Analysis Of The CyaaC-Cam With Pm | 1e-12 | ||
| 1fw4_A | 71 | Crystal Structure Of E. Coli Fragment Tr2c From Cal | 1e-12 | ||
| 2ro8_A | 79 | Solution Structure Of Calcium Bound Soybean Calmodu | 2e-12 | ||
| 2lhh_A | 128 | Solution Structure Of Ca2+-Bound Ycam Length = 128 | 4e-12 | ||
| 2lhh_A | 128 | Solution Structure Of Ca2+-Bound Ycam Length = 128 | 4e-09 | ||
| 2kz2_A | 94 | Calmodulin, C-Terminal Domain, F92e Mutant Length = | 5e-12 | ||
| 2rob_A | 70 | Solution Structure Of Calcium Bound Soybean Calmodu | 6e-12 | ||
| 2kn2_A | 92 | Solution Structure Of The C-Terminal Domain Of Soyb | 6e-12 | ||
| 2ro9_A | 69 | Solution Structure Of Calcium Bound Soybean Calmodu | 8e-12 | ||
| 2rrt_A | 72 | Solution Structure Of Magnesium-Bound Form Of Calmo | 1e-11 | ||
| 2col_B | 67 | Crystal Structure Analysis Of CyaaC-Cam With Pyroph | 2e-11 | ||
| 1avs_A | 90 | X-Ray Crystallographic Study Of Calcium-Saturated N | 3e-11 | ||
| 2kxw_A | 73 | Structure Of The C-Domain Fragment Of Apo Calmoduli | 4e-11 | ||
| 1trf_A | 76 | Solution Structure Of The Tr1c Fragment Of Skeletal | 4e-11 | ||
| 3fwb_A | 161 | Sac3:sus1:cdc31 Complex Length = 161 | 5e-11 | ||
| 2roa_A | 79 | Solution Structure Of Calcium Bound Soybean Calmodu | 6e-11 | ||
| 2ksz_A | 76 | The Solution Structure Of The Magnesium Bound Soybe | 6e-11 | ||
| 1aj4_A | 161 | Structure Of Calcium-Saturated Cardiac Troponin C, | 2e-10 | ||
| 1smg_A | 90 | Calcium-Bound E41a Mutant Of The N-Domain Of Chicke | 2e-10 | ||
| 1npq_A | 90 | Structure Of A Rhodamine-Labeled N-Domain Troponin | 2e-10 | ||
| 1dtl_A | 161 | Crystal Structure Of Calcium-Saturated (3ca2+) Card | 3e-10 | ||
| 1dtl_A | 161 | Crystal Structure Of Calcium-Saturated (3ca2+) Card | 8e-08 | ||
| 2lv7_A | 100 | Solution Structure Of Ca2+-Bound Cabp7 N-Terminal D | 4e-10 | ||
| 1br1_B | 150 | Smooth Muscle Myosin Motor Domain-Essential Light C | 4e-10 | ||
| 3j04_C | 148 | Em Structure Of The Heavy Meromyosin Subfragment Of | 4e-10 | ||
| 3j04_B | 143 | Em Structure Of The Heavy Meromyosin Subfragment Of | 5e-10 | ||
| 1m46_A | 148 | Crystal Structure Of Mlc1p Bound To Iq4 Of Myo2p, A | 5e-10 | ||
| 2gv5_A | 161 | Crystal Structure Of Sfi1pCDC31P COMPLEX Length = 1 | 5e-10 | ||
| 2jt0_A | 161 | Solution Structure Of F104w Cardiac Troponin C Leng | 6e-10 | ||
| 2jt0_A | 161 | Solution Structure Of F104w Cardiac Troponin C Leng | 8e-08 | ||
| 2w4a_C | 145 | Isometrically Contracting Insect Asynchronous Fligh | 7e-10 | ||
| 1m8q_C | 147 | Molecular Models Of Averaged Rigor Crossbridges Fro | 1e-09 | ||
| 2mys_C | 149 | Myosin Subfragment-1, Alpha Carbon Coordinates Only | 1e-09 | ||
| 1la0_A | 161 | Solution Structure Of Calcium Saturated Cardiac Tro | 1e-09 | ||
| 3tz1_A | 74 | Crystal Structure Of The Ca2+-saturated C-terminal | 2e-09 | ||
| 2jt3_A | 161 | Solution Structure Of F153w Cardiac Troponin C Leng | 2e-09 | ||
| 2jt3_A | 161 | Solution Structure Of F153w Cardiac Troponin C Leng | 8e-08 | ||
| 1s6i_A | 188 | Ca2+-Regulatory Region (Cld) From Soybean Calcium-D | 3e-09 | ||
| 1s6i_A | 188 | Ca2+-Regulatory Region (Cld) From Soybean Calcium-D | 6e-05 | ||
| 1f54_A | 77 | Solution Structure Of The Apo N-Terminal Domain Of | 3e-09 | ||
| 2jtz_A | 161 | Solution Structure And Chemical Shift Assignments O | 4e-09 | ||
| 2jtz_A | 161 | Solution Structure And Chemical Shift Assignments O | 9e-08 | ||
| 3pm8_A | 197 | Cad Domain Of Pff0520w, Calcium Dependent Protein K | 4e-09 | ||
| 2jt8_A | 161 | Solution Structure Of The F153-To-5-Flurotryptophan | 6e-09 | ||
| 2jt8_A | 161 | Solution Structure Of The F153-To-5-Flurotryptophan | 9e-08 | ||
| 3dtp_E | 196 | Tarantula Heavy Meromyosin Obtained By Flexible Doc | 7e-09 | ||
| 2aao_A | 166 | Regulatory Apparatus Of Calcium Dependent Protein K | 1e-08 | ||
| 2k2a_A | 70 | Solution Structure Of The Apo C Terminal Domain Of | 1e-08 | ||
| 2ggm_A | 172 | Human Centrin 2 Xeroderma Pigmentosum Group C Prote | 1e-08 | ||
| 1ggw_A | 140 | Cdc4p From Schizosaccharomyces Pombe Length = 140 | 2e-08 | ||
| 1oe9_B | 151 | Crystal Structure Of Myosin V Motor With Essential | 2e-08 | ||
| 2ctn_A | 89 | Structure Of Calcium-Saturated Cardiac Troponin C, | 3e-08 | ||
| 2kfx_T | 89 | Structure Of The N-Terminal Domain Of Human Cardiac | 4e-08 | ||
| 1wrk_A | 88 | Crystal Structure Of The N-Terminal Domain Of Human | 4e-08 | ||
| 2b1u_A | 71 | Solution Structure Of Calmodulin-Like Skin Protein | 4e-08 | ||
| 3lij_A | 494 | Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) | 4e-08 | ||
| 2k7c_A | 72 | Nmr Structure Of Mg2+-Bound Cabp1 C-Domain Length = | 4e-08 | ||
| 3l19_A | 214 | Crystal Structure Of Calcium Binding Domain Of Cpcd | 4e-08 | ||
| 1zmz_A | 98 | Solution Structure Of The N-Terminal Domain (M1-S98 | 1e-07 | ||
| 2opo_A | 86 | Crystal Structure Of The Calcium-Binding Pollen All | 2e-07 | ||
| 2opo_A | 86 | Crystal Structure Of The Calcium-Binding Pollen All | 2e-06 | ||
| 4gjg_A | 89 | Crystal Structure Of The Amino-terminal Domain Of H | 2e-07 | ||
| 1r2u_A | 89 | Nmr Structure Of The N Domain Of Trout Cardiac Trop | 2e-07 | ||
| 3i5g_B | 153 | Crystal Structure Of Rigor-Like Squid Myosin S1 Len | 2e-07 | ||
| 2lc5_A | 85 | Calmodulin-Like Protein From Entamoeba Histolytica: | 3e-07 | ||
| 1h4b_A | 84 | Solution Structure Of The Birch Pollen Allergen Bet | 4e-07 | ||
| 1h4b_A | 84 | Solution Structure Of The Birch Pollen Allergen Bet | 7e-06 | ||
| 3o4y_A | 196 | Crystal Structure Of Cad Domain Of The Plasmodium V | 4e-07 | ||
| 1mxl_C | 89 | Structure Of Cardiac Troponin C-troponin I Complex | 4e-07 | ||
| 4gjf_A | 89 | Crystal Structure Of The Amino-terminal Domain Of H | 4e-07 | ||
| 3hx4_A | 508 | Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg | 5e-07 | ||
| 3hzt_A | 467 | Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 | 5e-07 | ||
| 3ku2_A | 507 | Crystal Structure Of Inactivated Form Of Cdpk1 From | 5e-07 | ||
| 3i79_A | 484 | Calcium-Dependent Protein Kinase 1 From Toxoplasma | 6e-07 | ||
| 3k21_A | 191 | Crystal Structure Of Carboxy-Terminus Of Pfc0420w L | 7e-07 | ||
| 2ec6_B | 133 | Placopecten Striated Muscle Myosin Ii Length = 133 | 7e-07 | ||
| 3khe_A | 191 | Crystal Structure Of The Calcium-Loaded Calmodulin- | 8e-07 | ||
| 2os8_B | 157 | Rigor-Like Structures Of Muscle Myosins Reveal Key | 1e-06 | ||
| 2kgb_C | 89 | Nmr Solution Of The Regulatory Domain Cardiac F77w- | 1e-06 | ||
| 2jxl_A | 89 | Solution Structure Of Cardiac N-Domain Troponin C M | 1e-06 | ||
| 3i5g_C | 159 | Crystal Structure Of Rigor-Like Squid Myosin S1 Len | 1e-06 | ||
| 1jfj_A | 134 | Nmr Solution Structure Of An Ef-Hand Calcium Bindin | 1e-06 | ||
| 2jnx_A | 134 | Nmr Derived Solution Structure Of An Ef-Hand Calciu | 1e-06 | ||
| 2nxq_A | 134 | Crystal Structure Of Calcium Binding Protein 1 From | 1e-06 | ||
| 1kk8_B | 139 | Scallop Myosin (S1-Adp-Befx) In The Actin-Detached | 1e-06 | ||
| 1dfk_Y | 139 | Nucleotide-Free Scallop Myosin S1-Near Rigor State | 1e-06 | ||
| 1scm_B | 145 | Structure Of The Regulatory Domain Of Scallop Myosi | 1e-06 | ||
| 1wdc_B | 156 | Scallop Myosin Regulatory Domain Length = 156 | 1e-06 | ||
| 2w4t_Y | 136 | Isometrically Contracting Insect Asynchronous Fligh | 2e-06 | ||
| 3tuy_B | 161 | Phosphorylated Light Chain Domain Of Scallop Smooth | 2e-06 | ||
| 3pn7_B | 161 | Visualizing New Hinges And A Potential Major Source | 2e-06 | ||
| 1k9u_A | 78 | Crystal Structure Of The Calcium-Binding Pollen All | 3e-06 | ||
| 2lvi_A | 77 | Solution Structure Of Apo-phl P 7 Length = 77 | 3e-06 | ||
| 3igo_A | 486 | Crystal Structure Of Cryptosporidium Parvum Cdpk1, | 3e-06 | ||
| 1m39_A | 89 | Solution Structure Of The C-Terminal Fragment (F86- | 4e-06 | ||
| 2mys_B | 166 | Myosin Subfragment-1, Alpha Carbon Coordinates Only | 6e-06 | ||
| 1m8q_B | 145 | Molecular Models Of Averaged Rigor Crossbridges Fro | 6e-06 | ||
| 2w4a_B | 150 | Isometrically Contracting Insect Asynchronous Fligh | 8e-06 | ||
| 3pat_A | 110 | Comparison Between The Crystal And The Solution Str | 8e-06 | ||
| 3i7c_A | 484 | Calcium-Dependent Protein Kinase 1 From Toxoplasma | 9e-06 | ||
| 3q5i_A | 504 | Crystal Structure Of Pbanka_031420 Length = 504 | 9e-06 | ||
| 2a4j_A | 79 | Solution Structure Of The C-Terminal Domain (T94-Y1 | 1e-05 | ||
| 2joj_A | 77 | Nmr Solution Structure Of N-Terminal Domain Of Eupl | 2e-05 | ||
| 2fce_A | 70 | Solution Structure Of C-Lobe Myosin Light Chain Fro | 2e-05 | ||
| 1bjf_A | 193 | Crystal Structure Of Recombinant Bovine Neurocalcin | 2e-05 | ||
| 2hf5_A | 68 | The Structure And Function Of A Novel Two-Site Calc | 3e-05 | ||
| 1oqp_A | 77 | Structure Of The Ca2+C-Terminal Domain Of Caltracti | 3e-05 | ||
| 1jc2_A | 76 | Complex Of The C-Domain Of Troponin C With Residues | 4e-05 | ||
| 1s6j_A | 87 | N-Terminal Region Of The Ca2+-Saturated Calcium Reg | 4e-05 | ||
| 1qx2_A | 76 | X-Ray Structure Of Calcium-Loaded Calbindomodulin ( | 4e-05 | ||
| 2p6b_B | 156 | Crystal Structure Of Human Calcineurin In Complex W | 6e-05 | ||
| 2jul_A | 256 | Nmr Structure Of Dream Length = 256 | 6e-05 | ||
| 3ll8_B | 155 | Crystal Structure Of Calcineurin In Complex With Ak | 6e-05 | ||
| 1mf8_B | 170 | Crystal Structure Of Human Calcineurin Complexed Wi | 7e-05 | ||
| 1tco_B | 169 | Ternary Complex Of A Calcineurin A Fragment, Calcin | 7e-05 | ||
| 2e6w_A | 100 | Solution Structure And Calcium Binding Properties O | 1e-04 | ||
| 3rv5_A | 89 | Crystal Structure Of Human Cardiac Troponin C Regul | 1e-04 | ||
| 2k7b_A | 76 | Nmr Structure Of Mg2+-Bound Cabp1 N-Domain Length = | 1e-04 | ||
| 2kqy_A | 108 | Solution Structure Of Avian Thymic Hormone Length = | 2e-04 | ||
| 3fs7_A | 109 | Crystal Structure Of Gallus Gallus Beta-Parvalbumin | 2e-04 | ||
| 1y1x_A | 191 | Structural Analysis Of A Homolog Of Programmed Cell | 3e-04 | ||
| 1wy9_A | 147 | Crystal Structure Of Microglia-Specific Protein, Ib | 4e-04 | ||
| 1ih0_A | 71 | Structure Of The C-Domain Of Human Cardiac Troponin | 5e-04 | ||
| 1ozs_A | 73 | C-Domain Of Human Cardiac Troponin C In Complex Wit | 5e-04 | ||
| 2bec_A | 202 | Crystal Structure Of Chp2 In Complex With Its Bindi | 6e-04 | ||
| 2ct9_A | 208 | The Crystal Structure Of Calcineurin B Homologous P | 6e-04 | ||
| 3ctn_A | 76 | Structure Of Calcium-Saturated Cardiac Troponin C, | 6e-04 | ||
| 2bl0_C | 142 | Physarum Polycephalum Myosin Ii Regulatory Domain L | 7e-04 | ||
| 2e30_A | 195 | Solution Structure Of The Cytoplasmic Region Of Na+ | 7e-04 | ||
| 1c7v_A | 81 | Nmr Solution Structure Of The Calcium-Bound C-Termi | 8e-04 |
| >pdb|1XFU|O Chain O, Crystal Structure Of Anthrax Edema Factor (ef) Truncation Mutant, Ef-delta 64 In Complex With Calmodulin Length = 149 | Back alignment and structure |
|
| >pdb|1XFU|O Chain O, Crystal Structure Of Anthrax Edema Factor (ef) Truncation Mutant, Ef-delta 64 In Complex With Calmodulin Length = 149 | Back alignment and structure |
| >pdb|3EKH|A Chain A, Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER Length = 449 | Back alignment and structure |
| >pdb|3EKH|A Chain A, Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER Length = 449 | Back alignment and structure |
| >pdb|3O77|A Chain A, The Structure Of Ca2+ Sensor (Case-16) Length = 415 | Back alignment and structure |
| >pdb|3O77|A Chain A, The Structure Of Ca2+ Sensor (Case-16) Length = 415 | Back alignment and structure |
| >pdb|2LV6|A Chain A, The Complex Between Ca-calmodulin And Skeletal Muscle Myosin Light Chain Kinase From Combination Of Nmr And Aqueous And Contrast-matched Saxs Data Length = 148 | Back alignment and structure |
| >pdb|2LV6|A Chain A, The Complex Between Ca-calmodulin And Skeletal Muscle Myosin Light Chain Kinase From Combination Of Nmr And Aqueous And Contrast-matched Saxs Data Length = 148 | Back alignment and structure |
| >pdb|3EK8|A Chain A, Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER Length = 449 | Back alignment and structure |
| >pdb|3EK8|A Chain A, Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER Length = 449 | Back alignment and structure |
| >pdb|3SG6|A Chain A, Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) Length = 450 | Back alignment and structure |
| >pdb|3SG6|A Chain A, Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) Length = 450 | Back alignment and structure |
| >pdb|3EVR|A Chain A, Crystal Structure Of Calcium Bound Monomeric Gcamp2 Length = 411 | Back alignment and structure |
| >pdb|3EVR|A Chain A, Crystal Structure Of Calcium Bound Monomeric Gcamp2 Length = 411 | Back alignment and structure |
| >pdb|3O78|A Chain A, The Structure Of Ca2+ Sensor (Case-12) Length = 415 | Back alignment and structure |
| >pdb|3O78|A Chain A, The Structure Of Ca2+ Sensor (Case-12) Length = 415 | Back alignment and structure |
| >pdb|3EVU|A Chain A, Crystal Structure Of Calcium Bound Dimeric Gcamp2, (#1) Length = 449 | Back alignment and structure |
| >pdb|3EVU|A Chain A, Crystal Structure Of Calcium Bound Dimeric Gcamp2, (#1) Length = 449 | Back alignment and structure |
| >pdb|3SG5|A Chain A, Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linker 1), Lp(Linker 2) Length = 448 | Back alignment and structure |
| >pdb|3SG5|A Chain A, Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linker 1), Lp(Linker 2) Length = 448 | Back alignment and structure |
| >pdb|3SG2|A Chain A, Crystal Structure Of Gcamp2-T116v,D381y Length = 449 | Back alignment and structure |
| >pdb|3SG2|A Chain A, Crystal Structure Of Gcamp2-T116v,D381y Length = 449 | Back alignment and structure |
| >pdb|3EWT|A Chain A, Crystal Structure Of Calmodulin Complexed With A Peptide Length = 154 | Back alignment and structure |
| >pdb|3EWT|A Chain A, Crystal Structure Of Calmodulin Complexed With A Peptide Length = 154 | Back alignment and structure |
| >pdb|1CM1|A Chain A, Motions Of Calmodulin-Single-Conformer Refinement Length = 148 | Back alignment and structure |
| >pdb|1CM1|A Chain A, Motions Of Calmodulin-Single-Conformer Refinement Length = 148 | Back alignment and structure |
| >pdb|4DJC|A Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCAM COMPLEX Length = 152 | Back alignment and structure |
| >pdb|4DJC|A Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCAM COMPLEX Length = 152 | Back alignment and structure |
| >pdb|1Y0V|H Chain H, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length = 146 | Back alignment and structure |
| >pdb|1Y0V|H Chain H, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length = 146 | Back alignment and structure |
| >pdb|3SG4|A Chain A, Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Length = 448 | Back alignment and structure |
| >pdb|3SG4|A Chain A, Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Length = 448 | Back alignment and structure |
| >pdb|3SG3|A Chain A, Crystal Structure Of Gcamp3-D380y Length = 449 | Back alignment and structure |
| >pdb|3SG3|A Chain A, Crystal Structure Of Gcamp3-D380y Length = 449 | Back alignment and structure |
| >pdb|1K93|D Chain D, Crystal Structure Of The Adenylyl Cyclase Domain Of Anthrax Edema Factor (Ef) In Complex With Calmodulin Length = 144 | Back alignment and structure |
| >pdb|1K93|D Chain D, Crystal Structure Of The Adenylyl Cyclase Domain Of Anthrax Edema Factor (Ef) In Complex With Calmodulin Length = 144 | Back alignment and structure |
| >pdb|3SG7|A Chain A, Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 448 | Back alignment and structure |
| >pdb|3SG7|A Chain A, Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 448 | Back alignment and structure |
| >pdb|2WEL|D Chain D, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 150 | Back alignment and structure |
| >pdb|2WEL|D Chain D, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 150 | Back alignment and structure |
| >pdb|1IQ5|A Chain A, CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE KINASE Fragment Length = 149 | Back alignment and structure |
| >pdb|1IQ5|A Chain A, CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE KINASE Fragment Length = 149 | Back alignment and structure |
| >pdb|1CDL|A Chain A, Target Enzyme Recognition By Calmodulin: 2.4 Angstroms Structure Of A Calmodulin-Peptide Complex Length = 147 | Back alignment and structure |
| >pdb|1CDL|A Chain A, Target Enzyme Recognition By Calmodulin: 2.4 Angstroms Structure Of A Calmodulin-Peptide Complex Length = 147 | Back alignment and structure |
| >pdb|1CDM|A Chain A, Modulation Of Calmodulin Plasticity In Molecular Recognition On The Basis Of X-Ray Structures Length = 144 | Back alignment and structure |
| >pdb|1CDM|A Chain A, Modulation Of Calmodulin Plasticity In Molecular Recognition On The Basis Of X-Ray Structures Length = 144 | Back alignment and structure |
| >pdb|2YGG|B Chain B, Complex Of Cambr And Cam Length = 150 | Back alignment and structure |
| >pdb|2YGG|B Chain B, Complex Of Cambr And Cam Length = 150 | Back alignment and structure |
| >pdb|2F2O|A Chain A, Structure Of Calmodulin Bound To A Calcineurin Peptide: A New Way Of Making An Old Binding Mode Length = 179 | Back alignment and structure |
| >pdb|2F2O|A Chain A, Structure Of Calmodulin Bound To A Calcineurin Peptide: A New Way Of Making An Old Binding Mode Length = 179 | Back alignment and structure |
| >pdb|2VAY|A Chain A, Calmodulin Complexed With Cav1.1 Iq Peptide Length = 146 | Back alignment and structure |
| >pdb|2VAY|A Chain A, Calmodulin Complexed With Cav1.1 Iq Peptide Length = 146 | Back alignment and structure |
| >pdb|1PRW|A Chain A, Crystal Structure Of Bovine Brain Ca++ Calmodulin In A Compact Form Length = 149 | Back alignment and structure |
| >pdb|1PRW|A Chain A, Crystal Structure Of Bovine Brain Ca++ Calmodulin In A Compact Form Length = 149 | Back alignment and structure |
| >pdb|1UP5|B Chain B, Chicken Calmodulin Length = 148 | Back alignment and structure |
| >pdb|1UP5|B Chain B, Chicken Calmodulin Length = 148 | Back alignment and structure |
| >pdb|2K0J|A Chain A, Solution Structure Of Cam Complexed To Drp1p Length = 148 | Back alignment and structure |
| >pdb|2K0J|A Chain A, Solution Structure Of Cam Complexed To Drp1p Length = 148 | Back alignment and structure |
| >pdb|2BE6|A Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaCAM COMPLEX Length = 150 | Back alignment and structure |
| >pdb|2BE6|A Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaCAM COMPLEX Length = 150 | Back alignment and structure |
| >pdb|3U0K|A Chain A, Crystal Structure Of The Genetically Encoded Calcium Indicator Rcamp Length = 440 | Back alignment and structure |
| >pdb|3U0K|A Chain A, Crystal Structure Of The Genetically Encoded Calcium Indicator Rcamp Length = 440 | Back alignment and structure |
| >pdb|2BBM|A Chain A, Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr Length = 148 | Back alignment and structure |
| >pdb|2BBM|A Chain A, Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr Length = 148 | Back alignment and structure |
| >pdb|2BKH|B Chain B, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 149 | Back alignment and structure |
| >pdb|2BKH|B Chain B, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 149 | Back alignment and structure |
| >pdb|1OOJ|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Calmodulin Length = 149 | Back alignment and structure |
| >pdb|1OOJ|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Calmodulin Length = 149 | Back alignment and structure |
| >pdb|2VB6|B Chain B, Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigor State ( Crystal Form 2) Length = 149 | Back alignment and structure |
| >pdb|2VB6|B Chain B, Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigor State ( Crystal Form 2) Length = 149 | Back alignment and structure |
| >pdb|1VRK|A Chain A, The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 Peptide Complex Length = 148 | Back alignment and structure |
| >pdb|1VRK|A Chain A, The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 Peptide Complex Length = 148 | Back alignment and structure |
| >pdb|1QS7|A Chain A, The 1.8 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 145 | Back alignment and structure |
| >pdb|1QTX|A Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 148 | Back alignment and structure |
| >pdb|1QTX|A Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 148 | Back alignment and structure |
| >pdb|1DMO|A Chain A, Calmodulin, Nmr, 30 Structures Length = 148 | Back alignment and structure |
| >pdb|1DMO|A Chain A, Calmodulin, Nmr, 30 Structures Length = 148 | Back alignment and structure |
| >pdb|2IX7|A Chain A, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 145 | Back alignment and structure |
| >pdb|2IX7|A Chain A, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 145 | Back alignment and structure |
| >pdb|4GOW|D Chain D, Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX COMPLEX Length = 144 | Back alignment and structure |
| >pdb|4GOW|D Chain D, Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX COMPLEX Length = 144 | Back alignment and structure |
| >pdb|1AHR|A Chain A, Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 | Back alignment and structure |
| >pdb|1AHR|A Chain A, Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 | Back alignment and structure |
| >pdb|4AQR|A Chain A, Crystal Structure Of A Calmodulin In Complex With The Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase Length = 149 | Back alignment and structure |
| >pdb|1DEG|A Chain A, The Linker Of Des-Glu84 Calmodulin Is Bent As Seen In The Crystal Structure Length = 142 | Back alignment and structure |
| >pdb|1DEG|A Chain A, The Linker Of Des-Glu84 Calmodulin Is Bent As Seen In The Crystal Structure Length = 142 | Back alignment and structure |
| >pdb|1RFJ|A Chain A, Crystal Structure Of Potato Calmodulin Pcm6 Length = 149 | Back alignment and structure |
| >pdb|1CLM|A Chain A, Structure Of Paramecium Tetraurelia Calmodulin At 1.8 Angstroms Resolution Length = 148 | Back alignment and structure |
| >pdb|1CLM|A Chain A, Structure Of Paramecium Tetraurelia Calmodulin At 1.8 Angstroms Resolution Length = 148 | Back alignment and structure |
| >pdb|1EXR|A Chain A, The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Calmodulin Length = 148 | Back alignment and structure |
| >pdb|1EXR|A Chain A, The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Calmodulin Length = 148 | Back alignment and structure |
| >pdb|2L1W|A Chain A, The Solution Structure Of Soybean Calmodulin Isoform 4 Complexed With The Vacuolar Calcium Atpase Bca1 Peptide Length = 149 | Back alignment and structure |
| >pdb|2L1W|A Chain A, The Solution Structure Of Soybean Calmodulin Isoform 4 Complexed With The Vacuolar Calcium Atpase Bca1 Peptide Length = 149 | Back alignment and structure |
| >pdb|3EKJ|A Chain A, Calcium-Free Gcamp2 (Calcium Binding Deficient Mutant) Length = 449 | Back alignment and structure |
| >pdb|3EKJ|A Chain A, Calcium-Free Gcamp2 (Calcium Binding Deficient Mutant) Length = 449 | Back alignment and structure |
| >pdb|1XFX|O Chain O, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 10 Millimolar Exogenously Added Calcium Chloride Length = 149 | Back alignment and structure |
| >pdb|1XFX|O Chain O, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 10 Millimolar Exogenously Added Calcium Chloride Length = 149 | Back alignment and structure |
| >pdb|1GGZ|A Chain A, Crystal Structure Of The Calmodulin-Like Protein (Hclp) From Human Epithelial Cells Length = 148 | Back alignment and structure |
| >pdb|1GGZ|A Chain A, Crystal Structure Of The Calmodulin-Like Protein (Hclp) From Human Epithelial Cells Length = 148 | Back alignment and structure |
| >pdb|1NIW|A Chain A, Crystal Structure Of Endothelial Nitric Oxide Synthase Peptide Bound To Calmodulin Length = 148 | Back alignment and structure |
| >pdb|1NIW|A Chain A, Crystal Structure Of Endothelial Nitric Oxide Synthase Peptide Bound To Calmodulin Length = 148 | Back alignment and structure |
| >pdb|1Y6W|A Chain A, Trapped Intermediate Of Calmodulin Length = 148 | Back alignment and structure |
| >pdb|1Y6W|A Chain A, Trapped Intermediate Of Calmodulin Length = 148 | Back alignment and structure |
| >pdb|2LMT|A Chain A, Nmr Structure Of Androcam Length = 148 | Back alignment and structure |
| >pdb|2LMT|A Chain A, Nmr Structure Of Androcam Length = 148 | Back alignment and structure |
| >pdb|2LHI|A Chain A, Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam Length = 176 | Back alignment and structure |
| >pdb|2LHI|A Chain A, Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam Length = 176 | Back alignment and structure |
| >pdb|1LKJ|A Chain A, Nmr Structure Of Apo Calmodulin From Yeast Saccharomyces Cerevisiae Length = 146 | Back alignment and structure |
| >pdb|1LKJ|A Chain A, Nmr Structure Of Apo Calmodulin From Yeast Saccharomyces Cerevisiae Length = 146 | Back alignment and structure |
| >pdb|4DS7|A Chain A, Crystal Structure Of Yeast Calmodulin Bound To The C-Terminal Fragment Of Spindle Pole Body Protein Spc110 Length = 147 | Back alignment and structure |
| >pdb|4DS7|A Chain A, Crystal Structure Of Yeast Calmodulin Bound To The C-Terminal Fragment Of Spindle Pole Body Protein Spc110 Length = 147 | Back alignment and structure |
| >pdb|2BL0|B Chain B, Physarum Polycephalum Myosin Ii Regulatory Domain Length = 145 | Back alignment and structure |
| >pdb|5TNC|A Chain A, Refined Crystal Structure Of Troponin C From Turkey Skeletal Muscle At 2.0 Angstroms Resolution Length = 162 | Back alignment and structure |
| >pdb|5TNC|A Chain A, Refined Crystal Structure Of Troponin C From Turkey Skeletal Muscle At 2.0 Angstroms Resolution Length = 162 | Back alignment and structure |
| >pdb|1TCF|A Chain A, Crystal Structure Of Calcium-Saturated Rabbit Skeletal Troponin C Length = 159 | Back alignment and structure |
| >pdb|1TCF|A Chain A, Crystal Structure Of Calcium-Saturated Rabbit Skeletal Troponin C Length = 159 | Back alignment and structure |
| >pdb|1A2X|A Chain A, Complex Of Troponin C With A 47 Residue (1-47) Fragment Of Troponin I Length = 159 | Back alignment and structure |
| >pdb|1A2X|A Chain A, Complex Of Troponin C With A 47 Residue (1-47) Fragment Of Troponin I Length = 159 | Back alignment and structure |
| >pdb|4TNC|A Chain A, Refined Structure Of Chicken Skeletal Muscle Troponin C In The Two-Calcium State At 2-Angstroms Resolution Length = 162 | Back alignment and structure |
| >pdb|4TNC|A Chain A, Refined Structure Of Chicken Skeletal Muscle Troponin C In The Two-Calcium State At 2-Angstroms Resolution Length = 162 | Back alignment and structure |
| >pdb|3OX6|A Chain A, Crystal Structure Of The Calcium Sensor Calcium-Binding Protein 1 (Cabp1) Length = 153 | Back alignment and structure |
| >pdb|2OBH|A Chain A, Centrin-Xpc Peptide Length = 143 | Back alignment and structure |
| >pdb|2OBH|A Chain A, Centrin-Xpc Peptide Length = 143 | Back alignment and structure |
| >pdb|2LAN|A Chain A, Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc Length = 167 | Back alignment and structure |
| >pdb|3KF9|A Chain A, Crystal Structure Of The SdcenSKMLCK COMPLEX Length = 149 | Back alignment and structure |
| >pdb|3KF9|A Chain A, Crystal Structure Of The SdcenSKMLCK COMPLEX Length = 149 | Back alignment and structure |
| >pdb|3OX5|A Chain A, Crystal Structure Of The Calcium Sensor Calcium-Binding Protein 1 (Cabp1) Length = 153 | Back alignment and structure |
| >pdb|3QRX|A Chain A, Chlamydomonas Reinhardtii Centrin Bound To Melittin Length = 169 | Back alignment and structure |
| >pdb|3QRX|A Chain A, Chlamydomonas Reinhardtii Centrin Bound To Melittin Length = 169 | Back alignment and structure |
| >pdb|1SW8|A Chain A, Solution Structure Of The N-Terminal Domain Of Human N60d Calmodulin Refined With Paramagnetism Based Strategy Length = 79 | Back alignment and structure |
| >pdb|1YTZ|C Chain C, Crystal Structure Of Skeletal Muscle Troponin In The Ca2+- Activated State Length = 162 | Back alignment and structure |
| >pdb|1YTZ|C Chain C, Crystal Structure Of Skeletal Muscle Troponin In The Ca2+- Activated State Length = 162 | Back alignment and structure |
| >pdb|2W49|0 Chain 0, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 159 | Back alignment and structure |
| >pdb|2W49|0 Chain 0, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 159 | Back alignment and structure |
| >pdb|2I08|A Chain A, Solvation Effect In Conformational Changes Of Ef-Hand Proteins: X-Ray Structure Of Ca2+-Saturated Double Mutant Q41l-K75i Of N-Domain Of Calmodulin Length = 78 | Back alignment and structure |
| >pdb|3B32|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-75 Length = 75 | Back alignment and structure |
| >pdb|1AK8|A Chain A, Nmr Solution Structure Of Cerium-Loaded Calmodulin Amino- Terminal Domain (Ce2-Tr1c), 23 Structures Length = 76 | Back alignment and structure |
| >pdb|2LQC|A Chain A, Nmr Solution Structure Of A Ca2+-Calmodulin With A Binding Motif (Nscate) Peptide From The N-Terminal Cytoplasmic Domain Of The L-Type Voltage-Cated Calcium Channel Alpha1c Subunit Length = 77 | Back alignment and structure |
| >pdb|3UCT|A Chain A, Structure Of Mn2+-Bound N-Terminal Domain Of Calmodulin In The Presence Of Zn2+ Length = 79 | Back alignment and structure |
| >pdb|1F70|A Chain A, Refined Solution Structure Of Calmodulin N-Terminal Domain Length = 76 | Back alignment and structure |
| >pdb|1J7O|A Chain A, Solution Structure Of Calcium-calmodulin N-terminal Domain Length = 76 | Back alignment and structure |
| >pdb|2LLO|A Chain A, Solution Nmr-Derived Structure Of Calmodulin N-Lobe Bound With Er Alpha Peptide Length = 80 | Back alignment and structure |
| >pdb|3IFK|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-90 Length = 90 | Back alignment and structure |
| >pdb|1TNW|A Chain A, Nmr Solution Structure Of Calcium Saturated Skeletal Muscle Troponin C Length = 162 | Back alignment and structure |
| >pdb|1TNW|A Chain A, Nmr Solution Structure Of Calcium Saturated Skeletal Muscle Troponin C Length = 162 | Back alignment and structure |
| >pdb|2JNF|A Chain A, Solution Structure Of Fly Troponin C, Isoform F1 Length = 158 | Back alignment and structure |
| >pdb|1F71|A Chain A, Refined Solution Structure Of Calmodulin C-Terminal Domain Length = 67 | Back alignment and structure |
| >pdb|2AMI|A Chain A, Solution Structure Of The Calcium-Loaded N-Terminal Sensor Domain Of Centrin Length = 96 | Back alignment and structure |
| >pdb|1YRU|B Chain B, Crystal Structure Analysis Of The Adenylyl Cyclaes Catalytic Domain Of Adenylyl Cyclase Toxin Of Bordetella Pertussis In Presence Of C-Terminal Calmodulin And 1mm Calcium Chloride Length = 74 | Back alignment and structure |
| >pdb|1CMF|A Chain A, Nmr Solution Structure Of Apo Calmodulin Carboxy-Terminal Domain Length = 73 | Back alignment and structure |
| >pdb|1ZOT|B Chain B, Crystal Structure Analysis Of The CyaaC-Cam With Pmeapp Length = 69 | Back alignment and structure |
| >pdb|1FW4|A Chain A, Crystal Structure Of E. Coli Fragment Tr2c From Calmodulin To 1.7 A Resolution Length = 71 | Back alignment and structure |
| >pdb|2RO8|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 1 N-Terminal Domain Length = 79 | Back alignment and structure |
| >pdb|2LHH|A Chain A, Solution Structure Of Ca2+-Bound Ycam Length = 128 | Back alignment and structure |
| >pdb|2LHH|A Chain A, Solution Structure Of Ca2+-Bound Ycam Length = 128 | Back alignment and structure |
| >pdb|2KZ2|A Chain A, Calmodulin, C-Terminal Domain, F92e Mutant Length = 94 | Back alignment and structure |
| >pdb|2ROB|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 4 C-Terminal Domain Length = 70 | Back alignment and structure |
| >pdb|2KN2|A Chain A, Solution Structure Of The C-Terminal Domain Of Soybean Calmodulin Isoform 4 Fused With The Calmodulin-Binding Domain Of Ntmkp1 Length = 92 | Back alignment and structure |
| >pdb|2RO9|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 1 C-Terminal Domain Length = 69 | Back alignment and structure |
| >pdb|2RRT|A Chain A, Solution Structure Of Magnesium-Bound Form Of Calmodulin C-Domain E104dE140D MUTANT Length = 72 | Back alignment and structure |
| >pdb|2COL|B Chain B, Crystal Structure Analysis Of CyaaC-Cam With Pyrophosphate Length = 67 | Back alignment and structure |
| >pdb|1AVS|A Chain A, X-Ray Crystallographic Study Of Calcium-Saturated N- Terminal Domain Of Troponin C Length = 90 | Back alignment and structure |
| >pdb|2KXW|A Chain A, Structure Of The C-Domain Fragment Of Apo Calmodulin Bound To The Iq Motif Of Nav1.2 Length = 73 | Back alignment and structure |
| >pdb|1TRF|A Chain A, Solution Structure Of The Tr1c Fragment Of Skeletal Muscle Troponin-C Length = 76 | Back alignment and structure |
| >pdb|3FWB|A Chain A, Sac3:sus1:cdc31 Complex Length = 161 | Back alignment and structure |
| >pdb|2ROA|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 4 N-Terminal Domain Length = 79 | Back alignment and structure |
| >pdb|2KSZ|A Chain A, The Solution Structure Of The Magnesium Bound Soybean Calmod Isoform 4 N-Domain Length = 76 | Back alignment and structure |
| >pdb|1AJ4|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 1 Structure Length = 161 | Back alignment and structure |
| >pdb|1SMG|A Chain A, Calcium-Bound E41a Mutant Of The N-Domain Of Chicken Troponin C, Nmr, 40 Structures Length = 90 | Back alignment and structure |
| >pdb|1NPQ|A Chain A, Structure Of A Rhodamine-Labeled N-Domain Troponin C Mutant (Ca2+ Saturated) In Complex With Skeletal Troponin I 115- 131 Length = 90 | Back alignment and structure |
| >pdb|1DTL|A Chain A, Crystal Structure Of Calcium-Saturated (3ca2+) Cardiac Troponin C Complexed With The Calcium Sensitizer Bepridil At 2.15 A Resolution Length = 161 | Back alignment and structure |
| >pdb|1DTL|A Chain A, Crystal Structure Of Calcium-Saturated (3ca2+) Cardiac Troponin C Complexed With The Calcium Sensitizer Bepridil At 2.15 A Resolution Length = 161 | Back alignment and structure |
| >pdb|2LV7|A Chain A, Solution Structure Of Ca2+-Bound Cabp7 N-Terminal Doman Length = 100 | Back alignment and structure |
| >pdb|1BR1|B Chain B, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 150 | Back alignment and structure |
| >pdb|3J04|C Chain C, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 148 | Back alignment and structure |
| >pdb|3J04|B Chain B, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 143 | Back alignment and structure |
| >pdb|1M46|A Chain A, Crystal Structure Of Mlc1p Bound To Iq4 Of Myo2p, A Class V Myosin Length = 148 | Back alignment and structure |
| >pdb|2GV5|A Chain A, Crystal Structure Of Sfi1pCDC31P COMPLEX Length = 161 | Back alignment and structure |
| >pdb|2JT0|A Chain A, Solution Structure Of F104w Cardiac Troponin C Length = 161 | Back alignment and structure |
| >pdb|2JT0|A Chain A, Solution Structure Of F104w Cardiac Troponin C Length = 161 | Back alignment and structure |
| >pdb|2W4A|C Chain C, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 145 | Back alignment and structure |
| >pdb|1M8Q|C Chain C, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 147 | Back alignment and structure |
| >pdb|2MYS|C Chain C, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 149 | Back alignment and structure |
| >pdb|1LA0|A Chain A, Solution Structure Of Calcium Saturated Cardiac Troponin C In The Troponin C-Troponin I Complex Length = 161 | Back alignment and structure |
| >pdb|3TZ1|A Chain A, Crystal Structure Of The Ca2+-saturated C-terminal Domain Of Akazara Scallop Troponin C In Complex With A Troponin I Fragment Length = 74 | Back alignment and structure |
| >pdb|2JT3|A Chain A, Solution Structure Of F153w Cardiac Troponin C Length = 161 | Back alignment and structure |
| >pdb|2JT3|A Chain A, Solution Structure Of F153w Cardiac Troponin C Length = 161 | Back alignment and structure |
| >pdb|1S6I|A Chain A, Ca2+-Regulatory Region (Cld) From Soybean Calcium-Dependent Protein Kinase-Alpha (Cdpk) In The Presence Of Ca2+ And The Junction Domain (Jd) Length = 188 | Back alignment and structure |
| >pdb|1S6I|A Chain A, Ca2+-Regulatory Region (Cld) From Soybean Calcium-Dependent Protein Kinase-Alpha (Cdpk) In The Presence Of Ca2+ And The Junction Domain (Jd) Length = 188 | Back alignment and structure |
| >pdb|1F54|A Chain A, Solution Structure Of The Apo N-Terminal Domain Of Yeast Calmodulin Length = 77 | Back alignment and structure |
| >pdb|2JTZ|A Chain A, Solution Structure And Chemical Shift Assignments Of The F104-To-5-Flurotryptophan Mutant Of Cardiac Troponin C Length = 161 | Back alignment and structure |
| >pdb|2JTZ|A Chain A, Solution Structure And Chemical Shift Assignments Of The F104-To-5-Flurotryptophan Mutant Of Cardiac Troponin C Length = 161 | Back alignment and structure |
| >pdb|3PM8|A Chain A, Cad Domain Of Pff0520w, Calcium Dependent Protein Kinase Length = 197 | Back alignment and structure |
| >pdb|2JT8|A Chain A, Solution Structure Of The F153-To-5-Flurotryptophan Mutant Of Human Cardiac Troponin C Length = 161 | Back alignment and structure |
| >pdb|2JT8|A Chain A, Solution Structure Of The F153-To-5-Flurotryptophan Mutant Of Human Cardiac Troponin C Length = 161 | Back alignment and structure |
| >pdb|3DTP|E Chain E, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 196 | Back alignment and structure |
| >pdb|2AAO|A Chain A, Regulatory Apparatus Of Calcium Dependent Protein Kinase From Arabidopsis Thaliana Length = 166 | Back alignment and structure |
| >pdb|2K2A|A Chain A, Solution Structure Of The Apo C Terminal Domain Of Lethoceru C Isoform F1 Length = 70 | Back alignment and structure |
| >pdb|2GGM|A Chain A, Human Centrin 2 Xeroderma Pigmentosum Group C Protein Complex Length = 172 | Back alignment and structure |
| >pdb|1GGW|A Chain A, Cdc4p From Schizosaccharomyces Pombe Length = 140 | Back alignment and structure |
| >pdb|1OE9|B Chain B, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 151 | Back alignment and structure |
| >pdb|2CTN|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 30 Structures Length = 89 | Back alignment and structure |
| >pdb|2KFX|T Chain T, Structure Of The N-Terminal Domain Of Human Cardiac Troponin C Bound To Calcium Ion And To The Inhibitor W7 Length = 89 | Back alignment and structure |
| >pdb|1WRK|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Cardiac Troponin C In Complex With Trifluoperazine (Orthrombic Crystal Form) Length = 88 | Back alignment and structure |
| >pdb|2B1U|A Chain A, Solution Structure Of Calmodulin-Like Skin Protein C Terminal Domain Length = 71 | Back alignment and structure |
| >pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 | Back alignment and structure |
| >pdb|2K7C|A Chain A, Nmr Structure Of Mg2+-Bound Cabp1 C-Domain Length = 72 | Back alignment and structure |
| >pdb|3L19|A Chain A, Crystal Structure Of Calcium Binding Domain Of Cpcdpk3, Cgd5_820 Length = 214 | Back alignment and structure |
| >pdb|1ZMZ|A Chain A, Solution Structure Of The N-Terminal Domain (M1-S98) Of Human Centrin 2 Length = 98 | Back alignment and structure |
| >pdb|2OPO|A Chain A, Crystal Structure Of The Calcium-Binding Pollen Allergen Che A 3 Length = 86 | Back alignment and structure |
| >pdb|2OPO|A Chain A, Crystal Structure Of The Calcium-Binding Pollen Allergen Che A 3 Length = 86 | Back alignment and structure |
| >pdb|4GJG|A Chain A, Crystal Structure Of The Amino-terminal Domain Of Human Cardiac Troponin C Mutant D2n/v28i/l29q/g30d (niqd) In Complex With Cadmium Length = 89 | Back alignment and structure |
| >pdb|1R2U|A Chain A, Nmr Structure Of The N Domain Of Trout Cardiac Troponin C At 30 C Length = 89 | Back alignment and structure |
| >pdb|3I5G|B Chain B, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 153 | Back alignment and structure |
| >pdb|2LC5|A Chain A, Calmodulin-Like Protein From Entamoeba Histolytica: Solution Structure And Calcium-Binding Properties Of A Partially Folded Protein Length = 85 | Back alignment and structure |
| >pdb|1H4B|A Chain A, Solution Structure Of The Birch Pollen Allergen Bet V 4 Length = 84 | Back alignment and structure |
| >pdb|1H4B|A Chain A, Solution Structure Of The Birch Pollen Allergen Bet V 4 Length = 84 | Back alignment and structure |
| >pdb|3O4Y|A Chain A, Crystal Structure Of Cad Domain Of The Plasmodium Vivax Cdpk, Pvx_11610 Length = 196 | Back alignment and structure |
| >pdb|1MXL|C Chain C, Structure Of Cardiac Troponin C-troponin I Complex Length = 89 | Back alignment and structure |
| >pdb|4GJF|A Chain A, Crystal Structure Of The Amino-terminal Domain Of Human Cardiac Troponin C Mutant L29q In Complex With Cadmium Length = 89 | Back alignment and structure |
| >pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 | Back alignment and structure |
| >pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 | Back alignment and structure |
| >pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 | Back alignment and structure |
| >pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 | Back alignment and structure |
| >pdb|3K21|A Chain A, Crystal Structure Of Carboxy-Terminus Of Pfc0420w Length = 191 | Back alignment and structure |
| >pdb|2EC6|B Chain B, Placopecten Striated Muscle Myosin Ii Length = 133 | Back alignment and structure |
| >pdb|3KHE|A Chain A, Crystal Structure Of The Calcium-Loaded Calmodulin-Like Domain Of The Cdpk, 541.M00134 From Toxoplasma Gondii Length = 191 | Back alignment and structure |
| >pdb|2OS8|B Chain B, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 157 | Back alignment and structure |
| >pdb|2KGB|C Chain C, Nmr Solution Of The Regulatory Domain Cardiac F77w-Troponin C In Complex With The Cardiac Troponin I 144-163 Switch Peptide Length = 89 | Back alignment and structure |
| >pdb|2JXL|A Chain A, Solution Structure Of Cardiac N-Domain Troponin C Mutant F77w-V82a Length = 89 | Back alignment and structure |
| >pdb|3I5G|C Chain C, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 159 | Back alignment and structure |
| >pdb|1JFJ|A Chain A, Nmr Solution Structure Of An Ef-Hand Calcium Binding Protein From Entamoeba Histolytica Length = 134 | Back alignment and structure |
| >pdb|2JNX|A Chain A, Nmr Derived Solution Structure Of An Ef-Hand Calcium Binding Protein From Entamoeba Histolytica Length = 134 | Back alignment and structure |
| >pdb|2NXQ|A Chain A, Crystal Structure Of Calcium Binding Protein 1 From Entamoeba Histolytica: A Novel Arrangement Of Ef Hand Motifs Length = 134 | Back alignment and structure |
| >pdb|1KK8|B Chain B, Scallop Myosin (S1-Adp-Befx) In The Actin-Detached Conformation Length = 139 | Back alignment and structure |
| >pdb|1DFK|Y Chain Y, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 139 | Back alignment and structure |
| >pdb|1SCM|B Chain B, Structure Of The Regulatory Domain Of Scallop Myosin At 2.8 Angstroms Resolution Length = 145 | Back alignment and structure |
| >pdb|1WDC|B Chain B, Scallop Myosin Regulatory Domain Length = 156 | Back alignment and structure |
| >pdb|2W4T|Y Chain Y, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 136 | Back alignment and structure |
| >pdb|3TUY|B Chain B, Phosphorylated Light Chain Domain Of Scallop Smooth Muscle Myosin Length = 161 | Back alignment and structure |
| >pdb|3PN7|B Chain B, Visualizing New Hinges And A Potential Major Source Of Compliance In The Lever Arm Of Myosin Length = 161 | Back alignment and structure |
| >pdb|1K9U|A Chain A, Crystal Structure Of The Calcium-Binding Pollen Allergen Phl P 7 (Polcalcin) At 1.75 Angstroem Length = 78 | Back alignment and structure |
| >pdb|2LVI|A Chain A, Solution Structure Of Apo-phl P 7 Length = 77 | Back alignment and structure |
| >pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 | Back alignment and structure |
| >pdb|1M39|A Chain A, Solution Structure Of The C-Terminal Fragment (F86-I165) Of The Human Centrin 2 In Calcium Saturated Form Length = 89 | Back alignment and structure |
| >pdb|2MYS|B Chain B, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 166 | Back alignment and structure |
| >pdb|1M8Q|B Chain B, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 145 | Back alignment and structure |
| >pdb|2W4A|B Chain B, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 150 | Back alignment and structure |
| >pdb|3PAT|A Chain A, Comparison Between The Crystal And The Solution Structures Of The Ef Hand Parvalbumin Length = 110 | Back alignment and structure |
| >pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 | Back alignment and structure |
| >pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 | Back alignment and structure |
| >pdb|2A4J|A Chain A, Solution Structure Of The C-Terminal Domain (T94-Y172) Of The Human Centrin 2 In Complex With A 17 Residues Peptide (P1-Xpc) From Xeroderma Pigmentosum Group C Protein Length = 79 | Back alignment and structure |
| >pdb|2JOJ|A Chain A, Nmr Solution Structure Of N-Terminal Domain Of Euplotes Octocarinatus Centrin Length = 77 | Back alignment and structure |
| >pdb|2FCE|A Chain A, Solution Structure Of C-Lobe Myosin Light Chain From Saccharomices Cerevisiae Length = 70 | Back alignment and structure |
| >pdb|1BJF|A Chain A, Crystal Structure Of Recombinant Bovine Neurocalcin Delta At 2.4 Angstroms Length = 193 | Back alignment and structure |
| >pdb|2HF5|A Chain A, The Structure And Function Of A Novel Two-Site Calcium- Binding Fragment Of Calmodulin Length = 68 | Back alignment and structure |
| >pdb|1OQP|A Chain A, Structure Of The Ca2+C-Terminal Domain Of Caltractin In Complex With The Cdc31p-Binding Domain From Kar1p Length = 77 | Back alignment and structure |
| >pdb|1JC2|A Chain A, Complex Of The C-Domain Of Troponin C With Residues 1-40 Of Troponin I Length = 76 | Back alignment and structure |
| >pdb|1S6J|A Chain A, N-Terminal Region Of The Ca2+-Saturated Calcium Regulatory Domain (Cld) From Soybean Calcium-Dependent Protein Kinase- Alpha (Cdpk) Length = 87 | Back alignment and structure |
| >pdb|1QX2|A Chain A, X-Ray Structure Of Calcium-Loaded Calbindomodulin (A Calbindin D9k Re- Engineered To Undergo A Conformational Opening) At 1.44 A Resolution Length = 76 | Back alignment and structure |
| >pdb|2P6B|B Chain B, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 156 | Back alignment and structure |
| >pdb|2JUL|A Chain A, Nmr Structure Of Dream Length = 256 | Back alignment and structure |
| >pdb|3LL8|B Chain B, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 155 | Back alignment and structure |
| >pdb|1MF8|B Chain B, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 170 | Back alignment and structure |
| >pdb|1TCO|B Chain B, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 169 | Back alignment and structure |
| >pdb|2E6W|A Chain A, Solution Structure And Calcium Binding Properties Of Ef- Hands 3 And 4 Of Calsenilin Length = 100 | Back alignment and structure |
| >pdb|3RV5|A Chain A, Crystal Structure Of Human Cardiac Troponin C Regulatory Domain In Complex With Cadmium And Deoxycholic Acid Length = 89 | Back alignment and structure |
| >pdb|2K7B|A Chain A, Nmr Structure Of Mg2+-Bound Cabp1 N-Domain Length = 76 | Back alignment and structure |
| >pdb|2KQY|A Chain A, Solution Structure Of Avian Thymic Hormone Length = 108 | Back alignment and structure |
| >pdb|3FS7|A Chain A, Crystal Structure Of Gallus Gallus Beta-Parvalbumin (Avian Thymic Hormone) Length = 109 | Back alignment and structure |
| >pdb|1Y1X|A Chain A, Structural Analysis Of A Homolog Of Programmed Cell Death 6 Protein From Leishmania Major Friedlin Length = 191 | Back alignment and structure |
| >pdb|1WY9|A Chain A, Crystal Structure Of Microglia-Specific Protein, Iba1 Length = 147 | Back alignment and structure |
| >pdb|1IH0|A Chain A, Structure Of The C-Domain Of Human Cardiac Troponin C In Complex With Ca2+ Sensitizer Emd 57033 Length = 71 | Back alignment and structure |
| >pdb|1OZS|A Chain A, C-Domain Of Human Cardiac Troponin C In Complex With The Inhibitory Region Of Human Cardiac Troponin I Length = 73 | Back alignment and structure |
| >pdb|2BEC|A Chain A, Crystal Structure Of Chp2 In Complex With Its Binding Region In Nhe1 And Insights Into The Mechanism Of Ph Regulation Length = 202 | Back alignment and structure |
| >pdb|2CT9|A Chain A, The Crystal Structure Of Calcineurin B Homologous Proein 1 (Chp1) Length = 208 | Back alignment and structure |
| >pdb|3CTN|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 30 Structures Length = 76 | Back alignment and structure |
| >pdb|2BL0|C Chain C, Physarum Polycephalum Myosin Ii Regulatory Domain Length = 142 | Back alignment and structure |
| >pdb|2E30|A Chain A, Solution Structure Of The Cytoplasmic Region Of Na+H+ Exchanger 1 Complexed With Essential Cofactor Calcineurin B Homologous Protein 1 Length = 195 | Back alignment and structure |
| >pdb|1C7V|A Chain A, Nmr Solution Structure Of The Calcium-Bound C-Terminal Domain (W81-S161) Of Calcium Vector Protein From Amphioxus Length = 81 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 195 | |||
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 1e-61 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 6e-22 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 1e-60 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 1e-22 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 4e-22 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 1e-60 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 9e-32 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 8e-22 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 3e-04 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 3e-60 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 3e-22 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 4e-60 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 1e-22 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 1e-20 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 5e-60 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 3e-22 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 9e-60 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 2e-22 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 1e-59 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 1e-23 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 5e-20 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 2e-59 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 6e-22 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 6e-22 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 2e-59 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 7e-23 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 4e-18 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 1e-58 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 3e-20 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 5e-58 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 1e-22 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 8e-20 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 1e-55 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 3e-20 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 2e-55 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 2e-31 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 4e-06 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 9e-55 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 5e-22 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 9e-55 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 5e-54 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 3e-29 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 2e-21 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 1e-10 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 5e-54 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 1e-27 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 1e-04 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 2e-53 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 2e-20 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 3e-53 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 3e-53 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 6e-21 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 5e-53 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 7e-20 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 6e-53 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 3e-20 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 6e-53 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 2e-16 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 2e-52 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 3e-52 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 2e-20 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 8e-09 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 1e-51 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 4e-21 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 4e-51 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 2e-08 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 5e-51 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 5e-16 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 8e-51 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 2e-18 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 6e-49 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 5e-20 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 7e-17 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 2e-12 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 2e-48 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 8e-26 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 5e-48 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 3e-16 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 1e-47 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 1e-47 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 3e-20 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 2e-47 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 1e-45 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 7e-31 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 5e-09 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 3e-47 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 4e-42 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 2e-46 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 8e-18 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 5e-46 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 2e-16 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 1e-45 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 2e-15 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 2e-11 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 1e-45 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 7e-45 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 8e-16 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 2e-44 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 3e-17 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 2e-44 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 1e-11 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 1e-43 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 5e-18 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 1e-13 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 1e-11 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 1e-41 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 2e-19 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 1e-15 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 8e-40 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 2e-12 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 1e-39 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 1e-13 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 2e-12 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 3e-10 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 2e-37 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 3e-19 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 5e-37 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 4e-36 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 3e-36 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 4e-35 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 2e-19 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 4e-34 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 1e-17 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 3e-33 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 7e-19 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 5e-33 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 1e-12 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 1e-32 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 7e-19 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 2e-10 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 2e-32 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 4e-13 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 4e-12 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 2e-08 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 2e-32 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 4e-11 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 3e-32 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 2e-19 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 3e-32 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 2e-19 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 4e-15 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 5e-32 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 2e-13 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 1e-10 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 8e-32 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 6e-13 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 2e-11 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 3e-09 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 1e-31 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 4e-13 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 2e-12 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 1e-08 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 1e-31 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 2e-24 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 1e-31 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 1e-24 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 2e-31 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 4e-10 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 2e-06 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 2e-31 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 2e-15 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 5e-08 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 2e-31 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 2e-10 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 3e-31 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 4e-26 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 3e-31 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 8e-19 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 5e-31 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 9e-19 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 9e-31 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 1e-17 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 3e-30 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 2e-24 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 3e-30 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 3e-19 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 1e-29 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 3e-26 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 2e-29 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 5e-27 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 2e-29 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 2e-18 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 1e-14 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 4e-29 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 2e-09 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 1e-06 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 6e-29 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 4e-26 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 8e-29 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 2e-24 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 1e-28 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 1e-26 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 1e-28 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 8e-24 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 2e-28 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 4e-28 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 2e-28 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 3e-27 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 1e-27 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 1e-18 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 2e-27 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 7e-24 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 9e-27 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 4e-10 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 1e-08 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 7e-06 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 1e-26 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 2e-24 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 3e-26 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 3e-24 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 2e-25 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 4e-08 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 7e-08 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 1e-24 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 1e-19 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 1e-22 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 2e-08 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 9e-05 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 6e-22 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 8e-11 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 6e-07 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 1e-21 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 6e-09 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 5e-05 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 2e-21 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 5e-18 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 4e-13 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 8e-04 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 3e-21 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 1e-09 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 3e-21 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 3e-20 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 4e-21 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 6e-09 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 2e-07 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 5e-04 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 8e-21 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 1e-06 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 2e-05 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 2e-20 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 8e-07 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 9e-20 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 3e-07 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 2e-18 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 6e-18 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 2e-18 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 1e-15 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 4e-08 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 5e-07 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 7e-15 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 7e-07 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 6e-14 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 7e-12 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 7e-10 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 1e-08 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 8e-05 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 1e-13 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 2e-09 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 1e-07 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 3e-04 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 3e-13 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 7e-08 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 7e-06 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 3e-11 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 7e-09 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 6e-11 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 2e-08 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 6e-11 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 7e-11 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 2e-08 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 3e-10 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 4e-08 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 3e-10 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 3e-09 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 6e-06 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 1e-09 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 3e-09 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 9e-09 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 2e-08 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 1e-08 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 1e-06 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 2e-08 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 3e-05 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 3e-08 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 4e-07 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 3e-07 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 4e-07 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 7e-07 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 3e-04 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 1e-06 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 1e-05 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 1e-06 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 5e-06 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 1e-06 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 6e-06 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 2e-06 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 5e-06 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 2e-06 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 2e-05 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 4e-06 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 6e-06 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 5e-05 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 7e-06 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 2e-04 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 1e-05 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 2e-04 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 1e-05 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 1e-04 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 2e-05 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 9e-05 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 2e-05 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 3e-04 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 2e-05 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 2e-05 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 1e-04 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 3e-05 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 1e-04 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 3e-05 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 2e-04 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 4e-05 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 2e-04 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 4e-05 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 6e-05 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 4e-05 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 8e-05 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 5e-04 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 2e-04 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 2e-04 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 2e-04 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 3e-04 |
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 | Back alignment and structure |
|---|
Score = 187 bits (478), Expect = 1e-61
Identities = 51/142 (35%), Positives = 82/142 (57%), Gaps = 3/142 (2%)
Query: 41 VHELRQVFNKFDANGDGKISASELGSILTSLGHAATEEELQKMVREIDADGDGFVDFDEF 100
+ E + F+ FDA+G G IS ELG+++ LG T+EEL ++ E+D DG G +DF+EF
Sbjct: 19 IAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEF 78
Query: 101 VELNT---KGVDSAEVMENLKDAFSVYDIDGNGSITAEELHQVLRSLGDDCTLAECRRMI 157
+ + K + E L + F ++D + +G I EEL ++LR+ G+ T + ++
Sbjct: 79 LVMMVRQMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGEILRATGEHVTEEDIEDLM 138
Query: 158 RGVDCDGDGTIDFEEFKVMMTA 179
+ D + DG IDF+EF MM
Sbjct: 139 KDSDKNNDGRIDFDEFLKMMEG 160
|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Length = 174 | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Length = 174 | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Length = 174 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Length = 78 | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Length = 78 | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Length = 103 | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Length = 103 | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Length = 96 | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Length = 96 | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Length = 93 | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Length = 93 | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106 | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106 | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Length = 100 | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Length = 100 | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Length = 93 | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Length = 93 | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Length = 113 | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Length = 113 | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Length = 106 | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Length = 106 | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Length = 261 | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Length = 93 | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Length = 93 | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Length = 95 | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Length = 95 | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Length = 101 | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Length = 101 | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Length = 90 | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Length = 90 | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Length = 99 | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Length = 99 | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Length = 139 | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Length = 95 | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Length = 95 | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Length = 92 | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Length = 92 | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Length = 99 | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Length = 99 | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Length = 92 | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Length = 92 | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Length = 229 | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Length = 179 | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Length = 179 | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Length = 123 | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Length = 100 | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Length = 113 | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Length = 113 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 195 | |||
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 99.97 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 99.97 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 99.96 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 99.96 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 99.96 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 99.96 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 99.96 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 99.96 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 99.96 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 99.96 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 99.95 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 99.95 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 99.95 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 99.95 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 99.95 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 99.95 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 99.95 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.95 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 99.95 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 99.94 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.94 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 99.94 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.94 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 99.94 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.94 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 99.94 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 99.94 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 99.94 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 99.93 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 99.93 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 99.93 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 99.93 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 99.93 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 99.93 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 99.93 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 99.93 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 99.92 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 99.92 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 99.92 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 99.92 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.92 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 99.92 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 99.92 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 99.92 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 99.92 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 99.91 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 99.91 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 99.91 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 99.91 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 99.91 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 99.91 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 99.91 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 99.91 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 99.91 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 99.91 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 99.9 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 99.9 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 99.9 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 99.9 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 99.89 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 99.89 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 99.89 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 99.89 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 99.89 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.89 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 99.88 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 99.88 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.88 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.87 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 99.87 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 99.87 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.87 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 99.87 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 99.87 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 99.87 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 99.87 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 99.86 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 99.86 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 99.86 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 99.86 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 99.86 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 99.85 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 99.85 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 99.85 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 99.85 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 99.85 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 99.85 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 99.84 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 99.79 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 99.78 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 99.78 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 99.77 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 99.77 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 99.77 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 99.76 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 99.76 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 99.76 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 99.75 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 99.75 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 99.74 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 99.74 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 99.72 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 99.7 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 99.69 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 99.69 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 99.68 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 99.67 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 99.66 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.65 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 99.65 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 99.65 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 99.64 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 99.64 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 99.64 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 99.63 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 99.63 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 99.62 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 99.61 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 99.6 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 99.6 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 99.58 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 99.55 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 99.54 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 99.54 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 99.52 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 99.52 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 99.52 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 99.52 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 99.51 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 99.51 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 99.51 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 99.51 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 99.51 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 99.51 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 99.51 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 99.5 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 99.48 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 99.48 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 99.48 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 99.47 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.47 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 99.46 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 99.46 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 99.45 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 99.45 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 99.45 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.44 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 99.44 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 99.43 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 99.43 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 99.43 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 99.42 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 99.42 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 99.42 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 99.42 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 99.42 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 99.42 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 99.41 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 99.41 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 99.41 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 99.41 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 99.4 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 99.4 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 99.4 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 99.4 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 99.4 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 99.39 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 99.39 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 99.39 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 99.39 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 99.39 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 99.39 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 99.39 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 99.39 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 99.39 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 99.38 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 99.38 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 99.38 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 99.38 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 99.38 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 99.37 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 99.37 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 99.37 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 99.36 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 99.36 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 99.36 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 99.36 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 99.36 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 99.36 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 99.36 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 99.36 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.35 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 99.35 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 99.35 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 99.35 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 99.35 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 99.35 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 99.34 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 99.34 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 99.34 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 99.34 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 99.34 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 99.34 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 99.34 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 99.33 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 99.33 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 99.33 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 99.33 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 99.33 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 99.33 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.33 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 99.33 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 99.32 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 99.32 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 99.32 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 99.32 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 99.32 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.32 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.32 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 99.31 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 99.31 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 99.31 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 99.31 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 99.31 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 99.31 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.3 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 99.3 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 99.3 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 99.29 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 99.29 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 99.29 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 99.29 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.29 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 99.29 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 99.29 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 99.29 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 99.28 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 99.28 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 99.28 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 99.28 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.28 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 99.28 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 99.27 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 99.27 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 99.27 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 99.27 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 99.26 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 99.26 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 99.25 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 99.25 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 99.25 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 99.25 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 99.25 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 99.25 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 99.25 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 99.24 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 99.24 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 99.24 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 99.24 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 99.23 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 99.22 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 99.22 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 99.22 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 99.22 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 99.22 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 99.22 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 99.22 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 99.22 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 99.21 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 99.2 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 99.2 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 99.2 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 99.2 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 99.19 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 99.19 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 99.19 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 99.19 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 99.18 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 99.18 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 99.17 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 99.17 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 99.17 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.16 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 99.16 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 99.15 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 99.14 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.13 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 99.11 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 99.11 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 99.11 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 99.11 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 99.1 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 99.1 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 99.09 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 99.09 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 99.09 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 99.08 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 99.07 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 99.06 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 99.06 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 99.05 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 99.04 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 98.94 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 98.94 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 98.88 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 98.74 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 98.6 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 98.5 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 98.5 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 98.48 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 98.4 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 98.18 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 98.17 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 98.07 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 97.96 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 97.84 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 97.28 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 97.06 | |
| 3tdu_A | 200 | DCN1-like protein 1; E2:E3, ligase-protein binding | 96.76 | |
| 1pul_A | 125 | Hypothetical protein C32E8.3 in chromosome I; alph | 96.45 | |
| 3bq3_A | 270 | Defective in cullin neddylation protein 1; ubiquit | 96.39 | |
| 2kav_A | 129 | Sodium channel protein type 2 subunit alpha; volta | 96.38 | |
| 4gba_A | 221 | DCN1-like protein 3; E3 ligase, ligase-peptide com | 96.35 | |
| 3kev_A | 199 | Galieria sulfuraria DCUN1 domain-containing prote; | 96.21 | |
| 1wlm_A | 151 | Protein CGI-38; structural genomics, NPPSFA, natio | 95.98 | |
| 4dck_A | 168 | Sodium channel protein type 5 subunit alpha; IQ-mo | 95.83 | |
| 2jrf_A | 184 | Tubulin polymerization-promoting protein family me | 95.67 | |
| 1pul_A | 125 | Hypothetical protein C32E8.3 in chromosome I; alph | 95.6 | |
| 3bux_B | 329 | E3 ubiquitin-protein ligase CBL; TKB, signal trans | 95.27 | |
| 1wlm_A | 151 | Protein CGI-38; structural genomics, NPPSFA, natio | 94.81 | |
| 2jrf_A | 184 | Tubulin polymerization-promoting protein family me | 94.74 | |
| 3kev_A | 199 | Galieria sulfuraria DCUN1 domain-containing prote; | 94.35 | |
| 3tdu_A | 200 | DCN1-like protein 1; E2:E3, ligase-protein binding | 93.88 | |
| 4gba_A | 221 | DCN1-like protein 3; E3 ligase, ligase-peptide com | 93.74 | |
| 3op0_A | 323 | Signal transduction protein CBL-C; structural geno | 92.63 | |
| 2kav_A | 129 | Sodium channel protein type 2 subunit alpha; volta | 92.38 | |
| 2l5y_A | 150 | Stromal interaction molecule 2; EF-hand, SAM domai | 91.92 | |
| 4dh2_B | 82 | Dockerin type 1; cellulosome, cohesin, type I cohe | 91.38 | |
| 2l5y_A | 150 | Stromal interaction molecule 2; EF-hand, SAM domai | 90.58 | |
| 3bq3_A | 270 | Defective in cullin neddylation protein 1; ubiquit | 90.34 | |
| 4fl4_A | 88 | Glycoside hydrolase family 9; structural genomics, | 89.74 | |
| 4fl4_A | 88 | Glycoside hydrolase family 9; structural genomics, | 89.32 | |
| 3uo9_A | 534 | Glutaminase kidney isoform, mitochondrial; hydrola | 88.71 | |
| 4dck_A | 168 | Sodium channel protein type 5 subunit alpha; IQ-mo | 88.2 | |
| 4dh2_B | 82 | Dockerin type 1; cellulosome, cohesin, type I cohe | 87.55 | |
| 2k60_A | 150 | Protein (stromal interaction molecule 1); EF-hand, | 87.23 | |
| 3uo9_A | 534 | Glutaminase kidney isoform, mitochondrial; hydrola | 84.8 | |
| 2ccl_B | 63 | Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d | 83.83 | |
| 2y3n_B | 71 | Cellulosomal family-48 processive glycoside hydro; | 83.51 | |
| 3bux_B | 329 | E3 ubiquitin-protein ligase CBL; TKB, signal trans | 83.4 | |
| 2ccl_B | 63 | Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d | 83.03 | |
| 2y3n_B | 71 | Cellulosomal family-48 processive glycoside hydro; | 82.56 | |
| 2k60_A | 150 | Protein (stromal interaction molecule 1); EF-hand, | 82.35 |
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
Probab=99.97 E-value=1.5e-29 Score=173.55 Aligned_cols=146 Identities=36% Similarity=0.682 Sum_probs=138.2
Q ss_pred CCCChHhHHHHHHHhhhhcCCCCCcccHHHHHHHHHHcCCCCCHHHHHHHHHHHccCCCCceeHHHHHHHHhhcCCcHHH
Q 029304 34 NNVIIPDVHELRQVFNKFDANGDGKISASELGSILTSLGHAATEEELQKMVREIDADGDGFVDFDEFVELNTKGVDSAEV 113 (195)
Q Consensus 34 ~~l~~~~~~~~~~~F~~~d~~~~g~l~~~e~~~~l~~~~~~~~~~~~~~l~~~~d~~~~~~i~~~eF~~~~~~~~~~~~~ 113 (195)
..||++++++++.+|..+|.+++|.|+.+||..+++.++..++..++..++..++.+++|.|+|.+|+..+.........
T Consensus 2 s~lt~eqi~el~~~F~~~D~d~~G~I~~~El~~~l~~~~~~~~~~~~~~~~~~~d~~~~g~i~~~ef~~~~~~~~~~~~~ 81 (148)
T 2lmt_A 2 SELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFCGIMAKQMRETDT 81 (148)
T ss_dssp CSCCSHHHHHHHHHHHHHHCSSCCEEEGGGHHHHHHHHTCCCCHHHHHHHHHHHHTTSTTEEEHHHHHHHHHHTTTTTTT
T ss_pred CCCCHHHHHHHHHHHHHHcCCCCCeECHHHHHHHHHhcCCCchHHHHHHHHHhcccCCCCcccHHHHHHHHHHHhcccCc
Confidence 46899999999999999999999999999999999999999999999999999999999999999999988876665555
Q ss_pred HHHHHHHHHhhcCCCCCcccHHHHHHHHHHhCCCCCHHHHHHHHHhhcCCCCcceeHHHHHHHHHc
Q 029304 114 MENLKDAFSVYDIDGNGSITAEELHQVLRSLGDDCTLAECRRMIRGVDCDGDGTIDFEEFKVMMTA 179 (195)
Q Consensus 114 ~~~~~~~f~~~D~~~~g~i~~~e~~~~l~~~~~~~~~~~~~~~~~~~d~~~~g~i~~~eF~~~l~~ 179 (195)
.+.+..+|+.+|.+++|+|+.+||+.++..+|..+++.++..++..+|.|++|.|+|+||+.+|..
T Consensus 82 ~~~l~~aF~~~D~d~~G~I~~~El~~~l~~~g~~~~~~e~~~l~~~~D~d~dG~I~~~EF~~~m~~ 147 (148)
T 2lmt_A 82 EEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQ 147 (148)
T ss_dssp HHHHHHHHHHHHSSCSSEECHHHHHHHHHHHTCCCCHHHHHHHHHHHCCSCCSSEEHHHHHHHHTT
T ss_pred HHHHHHHHHHHCCCCcCcCcHHHHHHHHHHcCccccHHHHHHHHHHhCCCCCCeEeHHHHHHHHhc
Confidence 678999999999999999999999999999999999999999999999999999999999998864
|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* | Back alignment and structure |
|---|
| >1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* | Back alignment and structure |
|---|
| >1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* | Back alignment and structure |
|---|
| >4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A | Back alignment and structure |
|---|
| >4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A | Back alignment and structure |
|---|
| >3uo9_A Glutaminase kidney isoform, mitochondrial; hydrolase-hydrolase inhibitor complex; HET: 04A; 2.30A {Homo sapiens} PDB: 3unw_A* 3ss3_A 3ss4_A 3ss5_A* | Back alignment and structure |
|---|
| >4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uo9_A Glutaminase kidney isoform, mitochondrial; hydrolase-hydrolase inhibitor complex; HET: 04A; 2.30A {Homo sapiens} PDB: 3unw_A* 3ss3_A 3ss4_A 3ss5_A* | Back alignment and structure |
|---|
| >2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B | Back alignment and structure |
|---|
| >2y3n_B Cellulosomal family-48 processive glycoside hydro; structrual protein-hydrolase complex, cellulosome; 1.90A {Bacteroides cellulosolvens} | Back alignment and structure |
|---|
| >3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* | Back alignment and structure |
|---|
| >2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B | Back alignment and structure |
|---|
| >2y3n_B Cellulosomal family-48 processive glycoside hydro; structrual protein-hydrolase complex, cellulosome; 1.90A {Bacteroides cellulosolvens} | Back alignment and structure |
|---|
| >2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 195 | ||||
| d1lkja_ | 146 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 8e-34 | |
| d1lkja_ | 146 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 1e-12 | |
| d1lkja_ | 146 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 7e-09 | |
| d2obha1 | 141 | a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien | 1e-32 | |
| d2obha1 | 141 | a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien | 1e-13 | |
| d2obha1 | 141 | a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien | 5e-08 | |
| d1exra_ | 146 | a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr | 1e-31 | |
| d1exra_ | 146 | a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr | 8e-09 | |
| d1topa_ | 162 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 2e-30 | |
| d1topa_ | 162 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 1e-06 | |
| d1dtla_ | 156 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 1e-27 | |
| d1dtla_ | 156 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 1e-06 | |
| d1w7jb1 | 139 | a.39.1.5 (B:11-149) Myosin Essential Chain {Human | 7e-27 | |
| d1bjfa_ | 181 | a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId | 5e-26 | |
| d1bjfa_ | 181 | a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId | 3e-09 | |
| d1bjfa_ | 181 | a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId | 1e-08 | |
| d1bjfa_ | 181 | a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId | 4e-08 | |
| d1bjfa_ | 181 | a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId | 9e-08 | |
| d1qxpa2 | 188 | a.39.1.8 (A:515-702) Calpain large subunit, C-term | 8e-26 | |
| d1qxpa2 | 188 | a.39.1.8 (A:515-702) Calpain large subunit, C-term | 3e-14 | |
| d1qxpa2 | 188 | a.39.1.8 (A:515-702) Calpain large subunit, C-term | 1e-09 | |
| d1k94a_ | 165 | a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta | 8e-26 | |
| d1k94a_ | 165 | a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta | 2e-14 | |
| d1jbaa_ | 189 | a.39.1.5 (A:) Guanylate cyclase activating protein | 1e-25 | |
| d1jbaa_ | 189 | a.39.1.5 (A:) Guanylate cyclase activating protein | 4e-09 | |
| d1uhka1 | 187 | a.39.1.5 (A:3-189) Calcium-regulated photoprotein | 1e-24 | |
| d1uhka1 | 187 | a.39.1.5 (A:3-189) Calcium-regulated photoprotein | 4e-07 | |
| d1pvaa_ | 109 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 6e-24 | |
| d1pvaa_ | 109 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 1e-14 | |
| d1pvaa_ | 109 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 3e-09 | |
| d1juoa_ | 172 | a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: | 9e-24 | |
| d1juoa_ | 172 | a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: | 6e-12 | |
| d1qv0a_ | 189 | a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr | 3e-23 | |
| d1qv0a_ | 189 | a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr | 9e-09 | |
| d1df0a1 | 186 | a.39.1.8 (A:515-700) Calpain large subunit, C-term | 3e-23 | |
| d1df0a1 | 186 | a.39.1.8 (A:515-700) Calpain large subunit, C-term | 2e-11 | |
| d5pala_ | 109 | a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis | 6e-23 | |
| d5pala_ | 109 | a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis | 7e-14 | |
| d2pvba_ | 107 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 7e-23 | |
| d2pvba_ | 107 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 4e-13 | |
| d2zfda1 | 183 | a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { | 2e-22 | |
| d2zfda1 | 183 | a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { | 7e-07 | |
| d2zfda1 | 183 | a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { | 2e-05 | |
| d1fpwa_ | 190 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 3e-22 | |
| d1fpwa_ | 190 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 1e-09 | |
| d1fpwa_ | 190 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 2e-04 | |
| d1alva_ | 173 | a.39.1.8 (A:) Calpain small (regulatory) subunit ( | 4e-22 | |
| d1alva_ | 173 | a.39.1.8 (A:) Calpain small (regulatory) subunit ( | 4e-11 | |
| d1m45a_ | 146 | a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye | 2e-21 | |
| d1m45a_ | 146 | a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye | 4e-07 | |
| d1rroa_ | 108 | a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) | 3e-21 | |
| d1rroa_ | 108 | a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) | 7e-13 | |
| d1wdcc_ | 152 | a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop | 4e-21 | |
| d1wdcc_ | 152 | a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop | 8e-05 | |
| d1rwya_ | 109 | a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta | 4e-21 | |
| d1rwya_ | 109 | a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta | 5e-13 | |
| d1rwya_ | 109 | a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta | 4e-08 | |
| d2scpa_ | 174 | a.39.1.5 (A:) Sarcoplasmic calcium-binding protein | 5e-21 | |
| d2scpa_ | 174 | a.39.1.5 (A:) Sarcoplasmic calcium-binding protein | 5e-09 | |
| d2scpa_ | 174 | a.39.1.5 (A:) Sarcoplasmic calcium-binding protein | 6e-07 | |
| d1nyaa_ | 176 | a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth | 5e-21 | |
| d1nyaa_ | 176 | a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth | 1e-08 | |
| d1ggwa_ | 140 | a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo | 6e-21 | |
| d1s6ca_ | 178 | a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera | 1e-20 | |
| d1s6ca_ | 178 | a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera | 1e-06 | |
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 1e-20 | |
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 2e-18 | |
| d1xo5a_ | 180 | a.39.1.5 (A:) Calcium- and integrin-binding protei | 5e-20 | |
| d1xo5a_ | 180 | a.39.1.5 (A:) Calcium- and integrin-binding protei | 1e-08 | |
| d1xo5a_ | 180 | a.39.1.5 (A:) Calcium- and integrin-binding protei | 5e-05 | |
| d2sasa_ | 185 | a.39.1.5 (A:) Sarcoplasmic calcium-binding protein | 6e-20 | |
| d1auib_ | 165 | a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch | 3e-19 | |
| d1auib_ | 165 | a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch | 4e-04 | |
| d1wdcb_ | 142 | a.39.1.5 (B:) Myosin Essential Chain {Bay scallop | 5e-19 | |
| d1wdcb_ | 142 | a.39.1.5 (B:) Myosin Essential Chain {Bay scallop | 1e-06 | |
| d1wdcb_ | 142 | a.39.1.5 (B:) Myosin Essential Chain {Bay scallop | 1e-04 | |
| d1s6ia_ | 182 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 1e-18 | |
| d1s6ia_ | 182 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 2e-07 | |
| d1s6ia_ | 182 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 2e-04 | |
| d1c7va_ | 68 | a.39.1.5 (A:) Calcium vector protein {Amphioxus (B | 2e-18 | |
| d1c7va_ | 68 | a.39.1.5 (A:) Calcium vector protein {Amphioxus (B | 2e-10 | |
| d1s6ja_ | 87 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 2e-18 | |
| d1s6ja_ | 87 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 2e-15 | |
| d1avsa_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 2e-18 | |
| d1avsa_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 1e-16 | |
| d2opoa1 | 81 | a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che | 3e-18 | |
| d2opoa1 | 81 | a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che | 6e-18 | |
| d2opoa1 | 81 | a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che | 7e-07 | |
| d1jfja_ | 134 | a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly | 5e-18 | |
| d1jc2a_ | 75 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 7e-18 | |
| d1jc2a_ | 75 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 1e-15 | |
| d1f54a_ | 77 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 2e-17 | |
| d1f54a_ | 77 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 6e-16 | |
| d1fi5a_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), | 2e-17 | |
| d1fi5a_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), | 7e-16 | |
| d1wrka1 | 82 | a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) | 3e-17 | |
| d1wrka1 | 82 | a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) | 5e-15 | |
| d2zkmx1 | 170 | a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human | 6e-17 | |
| d2zkmx1 | 170 | a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human | 6e-06 | |
| d2zkmx1 | 170 | a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human | 3e-05 | |
| d2zkmx1 | 170 | a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human | 3e-04 | |
| d2pq3a1 | 73 | a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T | 8e-17 | |
| d2pq3a1 | 73 | a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T | 9e-16 | |
| d1qx2a_ | 76 | a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax | 1e-16 | |
| d1qx2a_ | 76 | a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax | 4e-14 | |
| d1tiza_ | 67 | a.39.1.5 (A:) Calmodulin-related protein T21P5.17 | 1e-16 | |
| d1tiza_ | 67 | a.39.1.5 (A:) Calmodulin-related protein T21P5.17 | 1e-15 | |
| d1tiza_ | 67 | a.39.1.5 (A:) Calmodulin-related protein T21P5.17 | 2e-07 | |
| d1cb1a_ | 78 | a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax | 2e-16 | |
| d1cb1a_ | 78 | a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax | 2e-15 | |
| d1fw4a_ | 65 | a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: | 2e-16 | |
| d1fw4a_ | 65 | a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: | 2e-14 | |
| d2fcea1 | 61 | a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ | 9e-16 | |
| d2fcea1 | 61 | a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ | 1e-14 | |
| d3c1va1 | 93 | a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa | 9e-16 | |
| d3c1va1 | 93 | a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa | 3e-13 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 2e-15 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 1e-13 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 7e-13 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 7e-13 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 7e-04 | |
| d1hqva_ | 181 | a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous | 3e-15 | |
| d1hqva_ | 181 | a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous | 8e-08 | |
| d1hqva_ | 181 | a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous | 4e-05 | |
| d1hqva_ | 181 | a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous | 2e-04 | |
| d1yuta1 | 98 | a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa | 7e-15 | |
| d1yuta1 | 98 | a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa | 3e-12 | |
| d1a4pa_ | 92 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 2e-14 | |
| d1a4pa_ | 92 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 6e-13 | |
| d1ksoa_ | 93 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 3e-14 | |
| d1ksoa_ | 93 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 5e-13 | |
| d1y1xa_ | 182 | a.39.1.8 (A:) Programmed cell death 6 protein-like | 5e-14 | |
| d1y1xa_ | 182 | a.39.1.8 (A:) Programmed cell death 6 protein-like | 3e-07 | |
| d1k8ua_ | 89 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 6e-14 | |
| d1k8ua_ | 89 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 8e-11 | |
| d1snla_ | 99 | a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo | 1e-13 | |
| d1snla_ | 99 | a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo | 1e-12 | |
| d1zfsa1 | 93 | a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no | 2e-13 | |
| d1zfsa1 | 93 | a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no | 8e-11 | |
| d1xk4a1 | 87 | a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa | 5e-13 | |
| d1xk4a1 | 87 | a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa | 2e-10 | |
| d1wlza1 | 83 | a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H | 2e-12 | |
| d1wlza1 | 83 | a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H | 1e-10 | |
| d1g8ia_ | 187 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 2e-11 | |
| d1g8ia_ | 187 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 1e-08 | |
| d1g8ia_ | 187 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 1e-07 | |
| d1g8ia_ | 187 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 5e-06 | |
| d1psra_ | 100 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 3e-11 | |
| d1psra_ | 100 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 7e-10 | |
| d1c07a_ | 95 | a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: | 2e-10 | |
| d1c07a_ | 95 | a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: | 2e-10 | |
| d1e8aa_ | 87 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 5e-10 | |
| d1e8aa_ | 87 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 4e-09 | |
| d2jxca1 | 95 | a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ | 5e-10 | |
| d2jxca1 | 95 | a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ | 1e-08 | |
| d2hf5a1 | 33 | a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien | 2e-09 | |
| d2hf5a1 | 33 | a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien | 2e-08 | |
| d1fi6a_ | 92 | a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: | 1e-08 | |
| d1fi6a_ | 92 | a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: | 2e-08 | |
| d1omra_ | 201 | a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: | 2e-08 | |
| d1omra_ | 201 | a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: | 8e-07 | |
| d1omra_ | 201 | a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: | 5e-05 | |
| d1iq3a_ | 110 | a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 | 9e-08 | |
| d1iq3a_ | 110 | a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 | 1e-06 | |
| d1qjta_ | 99 | a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: | 2e-07 | |
| d1qjta_ | 99 | a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: | 2e-07 | |
| d1qlsa_ | 95 | a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), | 7e-07 | |
| d1qlsa_ | 95 | a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), | 1e-04 | |
| d3cr5x1 | 90 | a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos tauru | 8e-07 | |
| d3cr5x1 | 90 | a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos tauru | 1e-04 | |
| d1j55a_ | 94 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 1e-05 | |
| d1j55a_ | 94 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 7e-04 | |
| d1sraa_ | 151 | a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPAR | 6e-05 | |
| d1xk4c1 | 83 | a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sa | 2e-04 | |
| d1xk4c1 | 83 | a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sa | 0.001 |
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Calmodulin-like domain: Calmodulin species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 115 bits (289), Expect = 8e-34
Identities = 51/139 (36%), Positives = 88/139 (63%), Gaps = 1/139 (0%)
Query: 40 DVHELRQVFNKFDANGDGKISASELGSILTSLGHAATEEELQKMVREIDADGDGFVDFDE 99
+ E ++ F FD + +G IS+SEL +++ SLG + +E E+ ++ EID DG+ ++F E
Sbjct: 8 QIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSE 67
Query: 100 FVELNTKGVDSAEVMENLKDAFSVYDIDGNGSITAEELHQVLRSLGDDCTLAECRRMIRG 159
F+ L ++ + S + + L +AF V+D +G+G I+A EL VL S+G+ T AE M+R
Sbjct: 68 FLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDDMLRE 127
Query: 160 VDCDGDGTIDFEEFKVMMT 178
V DG G I+ ++F +++
Sbjct: 128 VS-DGSGEINIQQFAALLS 145
|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Length = 95 | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Length = 95 | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Length = 90 | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Length = 90 | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Length = 151 | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 195 | |||
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 99.96 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 99.95 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.95 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.94 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 99.94 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 99.94 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.93 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 99.93 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 99.92 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 99.92 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.92 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 99.91 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 99.91 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 99.9 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 99.9 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 99.9 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 99.89 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 99.89 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 99.86 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 99.86 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 99.86 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 99.86 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 99.86 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 99.85 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 99.85 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 99.85 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 99.84 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 99.84 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 99.83 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 99.83 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 99.83 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 99.82 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 99.79 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.78 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 99.78 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.72 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 99.7 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.68 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 99.67 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 99.66 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.65 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 99.65 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 99.63 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 99.62 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.62 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 99.61 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.6 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 99.6 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 99.6 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 99.59 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 99.59 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 99.59 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 99.58 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 99.58 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.58 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.57 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.57 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 99.57 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 99.55 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 99.55 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.54 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 99.54 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 99.53 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.53 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.53 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 99.53 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 99.53 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 99.5 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 99.49 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 99.49 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.49 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 99.49 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 99.47 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 99.45 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 99.44 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.44 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 99.42 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.42 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.41 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 99.41 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.4 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 99.39 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 99.38 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 99.38 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 99.37 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 99.36 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 99.35 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 99.34 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 99.33 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.3 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 99.3 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 99.3 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.28 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 99.28 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.27 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.25 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 99.24 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 99.21 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 99.21 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 99.2 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 99.19 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 99.19 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 99.18 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 99.17 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 99.17 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 99.16 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.16 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 99.15 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.15 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 99.15 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 99.15 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 99.14 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 99.13 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 99.13 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 99.12 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 99.12 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.12 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 99.11 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 99.11 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.11 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 99.09 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 99.09 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 99.07 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 99.07 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 99.06 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.06 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 99.04 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 99.04 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 99.01 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 99.0 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 98.99 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.99 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 98.97 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 98.97 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.97 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 98.96 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.95 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 98.94 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 98.9 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 98.9 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 98.89 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 98.77 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 98.74 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 98.7 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 98.63 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 98.6 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.54 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 98.49 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 98.44 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 98.42 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 98.42 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 98.41 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 98.29 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 98.24 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 98.21 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 98.14 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 97.94 | |
| d1j7qa_ | 86 | Calcium vector protein {Amphioxus (Branchiostoma l | 97.58 | |
| d1sraa_ | 151 | C-terminal (EC) domain of BM-40/SPARC/osteonectin | 97.28 | |
| d1qasa1 | 94 | Phosphoinositide-specific phospholipase C, isozyme | 97.22 | |
| d1sraa_ | 151 | C-terminal (EC) domain of BM-40/SPARC/osteonectin | 97.1 | |
| d1qasa1 | 94 | Phosphoinositide-specific phospholipase C, isozyme | 96.04 | |
| d1h8ba_ | 73 | alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} | 95.42 | |
| d1wlma1 | 138 | Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 | 95.22 | |
| d1eg3a2 | 97 | Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | 94.71 | |
| d1j7qa_ | 86 | Calcium vector protein {Amphioxus (Branchiostoma l | 94.7 | |
| d1pula1 | 103 | Hypothetical protein c32e8.3 {Caenorhabditis elega | 94.39 | |
| d1pula1 | 103 | Hypothetical protein c32e8.3 {Caenorhabditis elega | 93.63 | |
| d1wlma1 | 138 | Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 | 93.6 | |
| d1h8ba_ | 73 | alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} | 93.26 | |
| d1dava_ | 71 | Cellulosome endoglucanase SS {Clostridium thermoce | 90.67 | |
| d2cclb1 | 59 | Endo-1,4-beta-xylanase Y {Clostridium thermocellum | 89.59 | |
| d2cclb1 | 59 | Endo-1,4-beta-xylanase Y {Clostridium thermocellum | 89.08 | |
| d2b59b1 | 60 | Cellulosomal scaffolding protein A {Clostridium th | 83.02 | |
| d1eg3a1 | 125 | Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | 81.85 | |
| d1dava_ | 71 | Cellulosome endoglucanase SS {Clostridium thermoce | 80.82 |
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Calmodulin-like domain: Calmodulin species: Ciliate (Paramecium tetraurelia) [TaxId: 5888]
Probab=99.96 E-value=2.5e-28 Score=165.41 Aligned_cols=145 Identities=44% Similarity=0.771 Sum_probs=136.7
Q ss_pred CCChHhHHHHHHHhhhhcCCCCCcccHHHHHHHHHHcCCCCCHHHHHHHHHHHccCCCCceeHHHHHHHHhhcCCcHHHH
Q 029304 35 NVIIPDVHELRQVFNKFDANGDGKISASELGSILTSLGHAATEEELQKMVREIDADGDGFVDFDEFVELNTKGVDSAEVM 114 (195)
Q Consensus 35 ~l~~~~~~~~~~~F~~~d~~~~g~l~~~e~~~~l~~~~~~~~~~~~~~l~~~~d~~~~~~i~~~eF~~~~~~~~~~~~~~ 114 (195)
+||++++++++++|..+|.+++|.|+.++|..++...+..++...+..++..++.+++|.|+|.+|+..+..........
T Consensus 2 ~lt~~e~~~l~~~F~~~D~~~~G~Is~~e~~~~l~~~~~~~~~~~~~~~~~~~d~~~~g~i~~~ef~~~~~~~~~~~~~~ 81 (146)
T d1exra_ 2 QLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSE 81 (146)
T ss_dssp CCCHHHHHHHHHHHHHHCTTCSSEECHHHHHHHHHHHTCCCCHHHHHHHHHHHCTTCSSSEEHHHHHHHHHHHHHHHHHH
T ss_pred CCCHHHHHHHHHHHHHHcCCCCCeECHHHHHHHHHhcCCCCCHHHHHHHHHhcCCCCCCcccHHHHHHHHHHHhhccChH
Confidence 68999999999999999999999999999999999999999999999999999999999999999999887655555556
Q ss_pred HHHHHHHHhhcCCCCCcccHHHHHHHHHHhCCCCCHHHHHHHHHhhcCCCCcceeHHHHHHHHHc
Q 029304 115 ENLKDAFSVYDIDGNGSITAEELHQVLRSLGDDCTLAECRRMIRGVDCDGDGTIDFEEFKVMMTA 179 (195)
Q Consensus 115 ~~~~~~f~~~D~~~~g~i~~~e~~~~l~~~~~~~~~~~~~~~~~~~d~~~~g~i~~~eF~~~l~~ 179 (195)
+.+..+|+.+|.+++|.|+..||+.++..+|..++++++..+|+.+|.|++|.|+|++|+.+|.+
T Consensus 82 ~~~~~~F~~~D~d~~G~i~~~e~~~~l~~~~~~~~~~~~~~i~~~~D~d~dG~i~~~eF~~~l~s 146 (146)
T d1exra_ 82 EELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVS 146 (146)
T ss_dssp HHHHHHHHHHSTTCSSCBCHHHHHHHHHHTTCCCCHHHHHHHHHHHCSSSSSSBCHHHHHHHHHC
T ss_pred HHHHHHHHHhCCCCCCcCCHHHHHHHHHHHhhcCCHHHHHHHHHHhCCCCCCeEeHHHHHHHhcC
Confidence 78999999999999999999999999999999999999999999999999999999999999864
|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1eg3a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d2b59b1 a.139.1.1 (B:104-163) Cellulosomal scaffolding protein A {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1eg3a1 a.39.1.7 (A:85-209) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|