Citrus Sinensis ID: 029305


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MKESVENPLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGACRLFNYGMGIHLLKSEEPDNLPKAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQLFFHDPDGSMIEICNCDVLPVVPLAGDAVRIRSCTSTVNCNFHQQQIQQEPQINPQSCLSDSIHAKEDFLHFAS
ccccccccccccEEcEEEEEcccHHHHHHHHHHHcccccccccccccccccEEEcccccEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHcccEEEEEECccccccEEEEEEEcccccEEEEEcccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccc
********LCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGACRLFNYGMGIHLLKSEEP*********INPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQLFFHDPDGSMIEICNCDVLPVVPLAGDAVRIRSCTSTVNCN***********************A***FLHFA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKESVENPLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGACRLFNYGMGIHLLKSEEPDNLPKAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQLFFHDPDGSMIEICNCDVLPVVPLAGDAVRIRSCTSTVNCNFHQQQIQQEPQINPQSCLSDSIHAKEDFLHFAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F1U, chain A
Confidence level:very confident
Coverage over the Query: 9-65,78-138
View the alignment between query and template
View the model in PyMOL
Template: 1MPY, chain A
Confidence level:very confident
Coverage over the Query: 10-68,79-192
View the alignment between query and template
View the model in PyMOL