Citrus Sinensis ID: 029315


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MCRQRQSMQQIVAVFLLILAAVFLSIGEGSSKRSSSGDPDHILFYGIVPVLVASVLSGLASALCQWASQVKKHSSYLMTIEMSIVGSLCLLASISKSPDGEAIRQHGFFYGWTPLTLIPVIFNSLGGILVGLVTSHAGGVRKGFVIVSALLVTAMLQFIFEGKPPSLYCLIALPLVVSSISIYQKYPYQVKKKEV
cccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccHHHHccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccc
*CRQRQSMQQIVAVFLLILAAVFLSIG*************HILFYGIVPVLVASVLSGLASALCQWASQVKKHSSYLMTIEMSIVGSLCLLASISKSPDGEAIRQHGFFYGWTPLTLIPVIFNSLGGILVGLVTSHAGGVRKGFVIVSALLVTAMLQFIFEGKPPSLYCLIALPLVVSSISIYQKYPYQ******
xxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCRQRQSMQQIVAVFLLILAAVFLSIGEGSSKRSSSGDPDHILFYGIVPVLVASVLSGLASALCQWASQVKKHSSYLMTIEMSIVGSLCLLASISKSPDGEAIRQHGFFYGWTPLTLIPVIFNSLGGILVGLVTSHAGGVRKGFVIVSALLVTAMLQFIFEGKPPSLYCLIALPLVVSSISIYQKYPYQVKKKEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CMP-sialic acid transporter 5 Sugar transporter involved in the transport of CMP-sialic acid from the cytoplasm into the Golgi.probableQ8LES0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 118-186
View the alignment between query and template
View the model in PyMOL
Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 1-27
View the alignment between query and template
View the model in PyMOL