Citrus Sinensis ID: 029338

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MIERRKDDSAASPEAKRKKKSKMKNKRRFSDEQIRLLESIFESESTKLEPRKKMQVATELGLQPRQVAIWFQNKRARWKSKQIEHDYAQLRANYDSLASGFESLIKEKESLLLELQMLNEQLGKSDYEINGVGKDLKRSDWSSSNRLNNNDNNDNNKSVDDFIASSEKWFNEDSGGLLDPSTSSSPQSHWLNFWV
ccccccccccccHHHHHHccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcc
mierrkddsaaspeakrkkkskmknkrrFSDEQIRLLESIFEsestkleprkkMQVATELGLQPRQVAIWFQNKRARWKSKQIEHDYAQLRANYDSLASGFESLIKEKESLLLELQMLNEqlgksdyeingvgkdlkrsdwsssnrlnnndnndnnksvDDFIASSEKwfnedsgglldpstssspqshwlnfwv
mierrkddsaaspeakrkkkskmknkrrfsdeqIRLLESifesestkleprKKMQVatelglqprqvAIWFQNKRARWKSKQIEHDYAQLRANYDSLASGFESLIKEKESLLLELQMLNEQLGKSDYEINGVGKdlkrsdwsssnrlnnndnndnnkSVDDFIASSEKWFNEDSGGlldpstssspqshwlnfwv
MIERRKDDsaaspeakrkkkskmknkrrFSDEQIRLLESIFESESTKLEPRKKMQVATELGLQPRQVAIWFQNKRARWKSKQIEHDYAQLRANYDSLASGFeslikekeslllelqmlneqlGKSDYEINGVGKDLKRsdwsssnrlnnndnndnnksvddFIASSEKWFNEDSGGLLDPSTSSSPQSHWLNFWV
**********************************************************ELGLQPRQVAIWFQNKRARWKSKQIEHDYAQLRANYDSLASGFESLIKEKESLLLELQMLNEQL*************************************************************************
*******************************EQIRLLESIFESESTKLEPRKKMQVATELGLQPRQVAIWFQN**************AQLRANYDSLASGFESLI*********************************************************************************QSHWLNFWV
****************************FSDEQIRLLESIFESESTKLEPRKKMQVATELGLQPRQVAIWFQNKRARWKSKQIEHDYAQLRANYDSLASGFESLIKEKESLLLELQMLNEQLGKSDYEINGVGKDLKRSDWSSSNRLNNNDNNDNNKSVDDFIASSEKWFNE****************HWLNFWV
**************************RRFSDEQIRLLESIFESESTKLEPRKKMQVATELGLQPRQVAIWFQNKRARWKSKQIEHDYAQLRANYDSLASGFESLIKEKESLLLELQMLNEQLG***********************************************************SSSPQSHWLNFWV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIERRKDDSAASPEAKRKKKSKMKNKRRFSDEQIRLLESIFESESTKLEPRKKMQVATELGLQPRQVAIWFQNKRARWKSKQIEHDYAQLRANYDSLASGxxxxxxxxxxxxxxxxxxxxxLGKSDYEINGVGKDLKRSDWSSSNRLNNNDNNDNNKSVDDFIASSEKWFNEDSGGLLDPSTSSSPQSHWLNFWV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query195 2.2.26 [Sep-21-2011]
P46897258 Homeobox-leucine zipper p yes no 0.528 0.399 0.701 1e-32
Q9M276235 Homeobox-leucine zipper p no no 0.482 0.4 0.726 9e-32
Q7XUJ5276 Homeobox-leucine zipper p yes no 0.466 0.329 0.659 5e-29
Q01IK0276 Homeobox-leucine zipper p N/A no 0.466 0.329 0.659 5e-29
Q651Z5249 Homeobox-leucine zipper p no no 0.492 0.385 0.639 1e-28
Q9XH35249 Homeobox-leucine zipper p N/A no 0.492 0.385 0.639 1e-28
A2X7U1262 Homeobox-leucine zipper p N/A no 0.497 0.370 0.618 2e-28
Q6H6S3261 Homeobox-leucine zipper p no no 0.441 0.329 0.674 5e-28
Q6Z248269 Homeobox-leucine zipper p no no 0.523 0.379 0.543 1e-25
A2YWC0269 Homeobox-leucine zipper p N/A no 0.523 0.379 0.543 1e-25
>sp|P46897|ATHB7_ARATH Homeobox-leucine zipper protein ATHB-7 OS=Arabidopsis thaliana GN=ATHB-7 PE=2 SV=2 Back     alignment and function desciption
 Score =  139 bits (350), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (81%), Gaps = 1/104 (0%)

Query: 25  NKRRFSDEQIRLLESIFESESTKLEPRKKMQVATELGLQPRQVAIWFQNKRARWKSKQIE 84
           N+RRFSDEQI+ LE +FESE T+LEPRKK+Q+A ELGLQPRQVAIWFQNKRARWKSKQ+E
Sbjct: 32  NQRRFSDEQIKSLEMMFESE-TRLEPRKKVQLARELGLQPRQVAIWFQNKRARWKSKQLE 90

Query: 85  HDYAQLRANYDSLASGFESLIKEKESLLLELQMLNEQLGKSDYE 128
            +Y  LR NYD+LAS FESL KEK++L+ ELQ L E   K   E
Sbjct: 91  TEYNILRQNYDNLASQFESLKKEKQALVSELQRLKEATQKKTQE 134
Probable transcription activator that may act as growth regulators in response to water deficit.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9M276|ATB12_ARATH Homeobox-leucine zipper protein ATHB-12 OS=Arabidopsis thaliana GN=ATHB-12 PE=2 SV=1 Back     alignment and function description
>sp|Q7XUJ5|HOX22_ORYSJ Homeobox-leucine zipper protein HOX22 OS=Oryza sativa subsp. japonica GN=HOX22 PE=2 SV=2 Back     alignment and function description
>sp|Q01IK0|HOX22_ORYSI Homeobox-leucine zipper protein HOX22 OS=Oryza sativa subsp. indica GN=HOX22 PE=2 SV=2 Back     alignment and function description
>sp|Q651Z5|HOX6_ORYSJ Homeobox-leucine zipper protein HOX6 OS=Oryza sativa subsp. japonica GN=HOX6 PE=2 SV=1 Back     alignment and function description
>sp|Q9XH35|HOX6_ORYSI Homeobox-leucine zipper protein HOX6 OS=Oryza sativa subsp. indica GN=HOX6 PE=2 SV=2 Back     alignment and function description
>sp|A2X7U1|HOX24_ORYSI Homeobox-leucine zipper protein HOX24 OS=Oryza sativa subsp. indica GN=HOX24 PE=2 SV=2 Back     alignment and function description
>sp|Q6H6S3|HOX24_ORYSJ Homeobox-leucine zipper protein HOX24 OS=Oryza sativa subsp. japonica GN=HOX24 PE=2 SV=1 Back     alignment and function description
>sp|Q6Z248|HOX20_ORYSJ Homeobox-leucine zipper protein HOX20 OS=Oryza sativa subsp. japonica GN=HOX20 PE=2 SV=1 Back     alignment and function description
>sp|A2YWC0|HOX20_ORYSI Homeobox-leucine zipper protein HOX20 OS=Oryza sativa subsp. indica GN=HOX20 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query195
399920241216 homeobox leucine zipper [Rosa rugosa] 0.989 0.893 0.518 4e-46
5031277219 homeobox leucine zipper protein [Prunus 0.943 0.840 0.5 5e-42
255549132240 homeobox protein, putative [Ricinus comm 0.917 0.745 0.474 1e-39
359806041251 uncharacterized protein LOC100793260 [Gl 0.943 0.733 0.466 4e-36
302398861236 HD domain class transcription factor [Ma 0.974 0.805 0.437 5e-35
302398835231 HD domain class transcription factor [Ma 0.958 0.809 0.454 5e-35
147864011261 hypothetical protein VITISV_008157 [Viti 0.738 0.551 0.555 1e-33
359489348249 PREDICTED: LOW QUALITY PROTEIN: homeobox 0.738 0.578 0.555 1e-33
356559845246 PREDICTED: LOW QUALITY PROTEIN: homeobox 0.579 0.459 0.646 2e-33
224130632238 predicted protein [Populus trichocarpa] 0.835 0.684 0.451 4e-33
>gi|399920241|gb|AFP55588.1| homeobox leucine zipper [Rosa rugosa] Back     alignment and taxonomy information
 Score =  189 bits (481), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 112/216 (51%), Positives = 139/216 (64%), Gaps = 23/216 (10%)

Query: 2   IERRKDDSAASPEAKRKKKSKMKNKRRFSDEQIRLLESIFESESTKLEPRKKMQVATELG 61
           +ER  +       AKRKK +K +N RRFSDEQI+LLESIFE++S KLEPR+K+QVA ELG
Sbjct: 1   MEREVESLQTHSTAKRKKNNKSQNSRRFSDEQIKLLESIFEADS-KLEPRRKVQVARELG 59

Query: 62  LQPRQVAIWFQNKRARWKSKQIEHDYAQLRANYDSLASGFESLIKEKESLLLELQMLNEQ 121
           LQPRQVAIWFQN+RARWKSKQIE D+  LR  YD LAS FESL +EK+SLL++L+ LN+ 
Sbjct: 60  LQPRQVAIWFQNRRARWKSKQIEQDFRTLRNEYDLLASKFESLKEEKQSLLIQLEKLNDL 119

Query: 122 LGKSD-YEINGVGKDL-----KRSDWSSSNRLNNNDNNDNNKSVDDF------------- 162
           +GK+  +E N  GKDL     K  D  ++    ++  +  N + DD              
Sbjct: 120 MGKTKVHEENMDGKDLEGSSNKDGDCETTEEKPSHLQSHKNFASDDVGNEGHEQLMNMCQ 179

Query: 163 ---IASSEKWFNEDSGGLLDPSTSSSPQSHWLNFWV 195
              I S E W   DSGGL DP  SSS  S WLNFW+
Sbjct: 180 VGAIVSPEDWHRFDSGGLFDPPRSSSATSQWLNFWI 215

Source: Rosa rugosa

Species: Rosa rugosa

Genus: Rosa

Family: Rosaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|5031277|gb|AAD38144.1|AF139497_1 homeobox leucine zipper protein [Prunus armeniaca] Back     alignment and taxonomy information
>gi|255549132|ref|XP_002515621.1| homeobox protein, putative [Ricinus communis] gi|223545259|gb|EEF46766.1| homeobox protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359806041|ref|NP_001241177.1| uncharacterized protein LOC100793260 [Glycine max] gi|255635107|gb|ACU17911.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|302398861|gb|ADL36725.1| HD domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|302398835|gb|ADL36712.1| HD domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|147864011|emb|CAN78962.1| hypothetical protein VITISV_008157 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359489348|ref|XP_002262950.2| PREDICTED: LOW QUALITY PROTEIN: homeobox-leucine zipper protein ATHB-7-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356559845|ref|XP_003548207.1| PREDICTED: LOW QUALITY PROTEIN: homeobox-leucine zipper protein ATHB-7-like [Glycine max] Back     alignment and taxonomy information
>gi|224130632|ref|XP_002320889.1| predicted protein [Populus trichocarpa] gi|222861662|gb|EEE99204.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query195
TAIR|locus:2079542235 HB-12 "homeobox 12" [Arabidops 0.369 0.306 0.767 1.6e-30
TAIR|locus:2062754258 HB-7 "homeobox 7" [Arabidopsis 0.369 0.279 0.767 2.9e-29
TAIR|locus:2084228272 HB-1 "homeobox 1" [Arabidopsis 0.353 0.253 0.614 1.2e-19
TAIR|locus:2041283311 HB6 "homeobox protein 6" [Arab 0.364 0.228 0.597 6.5e-19
TAIR|locus:2140055294 HB16 "homeobox protein 16" [Ar 0.353 0.234 0.6 8.3e-19
TAIR|locus:2168225312 HB5 "homeobox protein 5" [Arab 0.333 0.208 0.621 8.3e-19
TAIR|locus:2150901314 HB-3 "homeobox 3" [Arabidopsis 0.343 0.213 0.617 3.6e-18
TAIR|locus:2205075294 ATHB13 [Arabidopsis thaliana ( 0.333 0.221 0.606 1.6e-17
TAIR|locus:2102107286 HB20 "homeobox protein 20" [Ar 0.343 0.234 0.558 4.1e-17
TAIR|locus:2046263220 HB21 "homeobox protein 21" [Ar 0.338 0.3 0.552 1.4e-16
TAIR|locus:2079542 HB-12 "homeobox 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 282 (104.3 bits), Expect = 1.6e-30, Sum P(2) = 1.6e-30
 Identities = 56/73 (76%), Positives = 65/73 (89%)

Query:    29 FSDEQIRLLESIFESESTKLEPRKKMQVATELGLQPRQVAIWFQNKRARWKSKQIEHDYA 88
             FS+EQI+ LE IFESE T+LEPRKK+QVA ELGLQPRQVAIWFQNKRARWK+KQ+E +Y 
Sbjct:    34 FSEEQIKSLELIFESE-TRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLEKEYN 92

Query:    89 QLRANYDSLASGF 101
              LRANY++LAS F
Sbjct:    93 TLRANYNNLASQF 105
GO:0000976 "transcription regulatory region sequence-specific DNA binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA;ISS;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0009651 "response to salt stress" evidence=IGI;RCA
GO:0009737 "response to abscisic acid stimulus" evidence=IEP;RCA;IMP
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IDA
GO:0009414 "response to water deprivation" evidence=IEP
GO:0009615 "response to virus" evidence=IEP
GO:0006970 "response to osmotic stress" evidence=IEP
TAIR|locus:2062754 HB-7 "homeobox 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084228 HB-1 "homeobox 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041283 HB6 "homeobox protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140055 HB16 "homeobox protein 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168225 HB5 "homeobox protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150901 HB-3 "homeobox 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205075 ATHB13 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102107 HB20 "homeobox protein 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046263 HB21 "homeobox protein 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P46897ATHB7_ARATHNo assigned EC number0.70190.52820.3992yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00026135001
SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (232 aa)
(Vitis vinifera)
Predicted Functional Partners:
NCED2
SubName- Full=Chromosome chr10 scaffold_43, whole genome shotgun sequence; (424 aa)
      • 0.480

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
pfam0004657 pfam00046, Homeobox, Homeobox domain 9e-14
smart0038957 smart00389, HOX, Homeodomain 7e-13
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 1e-12
pfam0218345 pfam02183, HALZ, Homeobox associated leucine zippe 2e-09
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 2e-05
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 62.5 bits (153), Expect = 9e-14
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 1/56 (1%)

Query: 24 KNKRRFSDEQIRLLESIFESESTKLEPRKKMQVATELGLQPRQVAIWFQNKRARWK 79
          + +  F+ EQ+  LE  FE ++      ++ ++A +LGL  RQV +WFQN+RA+WK
Sbjct: 2  RKRTTFTPEQLEELEKEFE-KNRYPSAEEREELAKKLGLTERQVKVWFQNRRAKWK 56

Length = 57
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|202143 pfam02183, HALZ, Homeobox associated leucine zipper Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 195
KOG0483198 consensus Transcription factor HEX, contains HOX a 99.88
KOG0488309 consensus Transcription factor BarH and related HO 99.73
KOG0489261 consensus Transcription factor zerknullt and relat 99.7
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 99.68
KOG0850245 consensus Transcription factor DLX and related pro 99.67
KOG0843197 consensus Transcription factor EMX1 and related HO 99.67
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 99.66
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.66
KOG0487308 consensus Transcription factor Abd-B, contains HOX 99.65
KOG0494332 consensus Transcription factor CHX10 and related H 99.63
KOG0492246 consensus Transcription factor MSH, contains HOX d 99.62
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 99.62
KOG0493342 consensus Transcription factor Engrailed, contains 99.6
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.53
KOG0848317 consensus Transcription factor Caudal, contains HO 99.53
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.53
KOG4577383 consensus Transcription factor LIM3, contains LIM 99.5
KOG2251228 consensus Homeobox transcription factor [Transcrip 99.5
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.44
KOG0491194 consensus Transcription factor BSH, contains HOX d 99.42
COG5576156 Homeodomain-containing transcription factor [Trans 99.42
KOG3802398 consensus Transcription factor OCT-1, contains POU 99.3
KOG0486351 consensus Transcription factor PTX1, contains HOX 99.28
KOG0847288 consensus Transcription factor, contains HOX domai 99.27
KOG0844408 consensus Transcription factor EVX1, contains HOX 99.26
KOG0490235 consensus Transcription factor, contains HOX domai 99.03
KOG0775304 consensus Transcription factor SIX and related HOX 98.9
KOG0849354 consensus Transcription factor PRD and related pro 98.85
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 98.63
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.53
KOG0774334 consensus Transcription factor PBX and related HOX 98.34
KOG2252558 consensus CCAAT displacement protein and related h 98.19
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 98.16
KOG0490235 consensus Transcription factor, contains HOX domai 97.82
KOG1146 1406 consensus Homeobox protein [General function predi 96.95
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 96.91
KOG0773342 consensus Transcription factor MEIS1 and related H 96.72
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 95.42
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 93.97
PRK09413121 IS2 repressor TnpA; Reviewed 93.73
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 93.28
smart0034044 HALZ homeobox associated leucin zipper. 92.06
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 88.31
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 86.51
PRK13169110 DNA replication intiation control protein YabA; Re 86.11
smart0034044 HALZ homeobox associated leucin zipper. 85.82
KOG0709472 consensus CREB/ATF family transcription factor [Tr 84.15
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 83.46
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 82.74
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 82.56
KOG4571294 consensus Activating transcription factor 4 [Trans 82.55
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 81.92
KOG4196135 consensus bZIP transcription factor MafK [Transcri 81.34
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information 
Probab=99.88  E-value=1.3e-22  Score=168.60  Aligned_cols=111  Identities=48%  Similarity=0.753  Sum_probs=100.9

Q ss_pred             CCCCCCCCHHHHHHHHHHHhhcCCCCCHHHHHHHHHHhCCChhHHHHHHHhhHHHHHHHHhHHHHHHHHHhhHHHhhhhH
Q 029338           23 MKNKRRFSDEQIRLLESIFESESTKLEPRKKMQVATELGLQPRQVAIWFQNKRARWKSKQIEHDYAQLRANYDSLASGFE  102 (195)
Q Consensus        23 rr~R~~ft~eQ~~~Le~~F~~~~~~ps~~~r~~LA~~LgLt~rQVkvWFQNRRak~Krkq~~~e~~~l~~~~~~L~~~~~  102 (195)
                      ..++.+|+.+|+..||..|+.. .++.+.++..||.+|||.+|||+|||||||||||.++.+.++..|+.+|+.|..++.
T Consensus        51 ~~kk~Rlt~eQ~~~LE~~F~~~-~~L~p~~K~~LAk~LgL~pRQVavWFQNRRARwK~kqlE~d~~~Lk~~~~~l~~~~~  129 (198)
T KOG0483|consen   51 KGKKRRLTSEQVKFLEKSFESE-KKLEPERKKKLAKELGLQPRQVAVWFQNRRARWKTKQLEKDYESLKRQLESLRSEND  129 (198)
T ss_pred             ccccccccHHHHHHhHHhhccc-cccChHHHHHHHHhhCCChhHHHHHHhhccccccchhhhhhHHHHHHHHHHHhhhhh
Confidence            3446789999999999999999 999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHHHHHHHhcccccccCCccc
Q 029338          103 SLIKEKESLLLELQMLNEQLGKSDYEINGVGK  134 (195)
Q Consensus       103 ~l~~e~~~L~~e~~~l~~~l~~~~~~~~~~c~  134 (195)
                      .|..++..|..++..+...++.......+.|.
T Consensus       130 ~Lq~e~~eL~~~~~~~~~~~~~~~~~~~~~~~  161 (198)
T KOG0483|consen  130 RLQSEVQELVAELSSLKREMQKSPENTLTMCP  161 (198)
T ss_pred             HHHHHHHHHHHHHhhhhhhhccCcccccccCc
Confidence            99999999999999998888885444445554

>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>smart00340 HALZ homeobox associated leucin zipper Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>smart00340 HALZ homeobox associated leucin zipper Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 3e-05
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 3e-05
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 7e-05
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 1e-04
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 1e-04
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 1e-04
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 2e-04
1ztr_A61 Solution Structure Of Engrailed Homeodomain L16a Mu 2e-04
2e1o_A70 Solution Structure Of Rsgi Ruh-028, A Homeobox Doma 3e-04
2p81_A44 Engrailed Homeodomain Helix-Turn-Helix Motif Length 6e-04
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 7e-04
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure 
Iteration: 1

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
Query: 29 FSDEQIRLLESIFESESTKLEPRKKMQVATELGLQPRQVAIWFQNKRARWK 79
          FS EQ+  L+  F +E+  L  R++ Q+++ELGL   Q+ IWFQNKRA+ K
Sbjct: 10 FSSEQLARLKREF-NENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIK 59
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure
>pdb|1ZTR|A Chain A, Solution Structure Of Engrailed Homeodomain L16a Mutant Length = 61 Back     alignment and structure
>pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 Back     alignment and structure
>pdb|2P81|A Chain A, Engrailed Homeodomain Helix-Turn-Helix Motif Length = 44 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 2e-22
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 3e-12
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 5e-11
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 8e-11
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 1e-10
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 2e-10
3a01_A93 Homeodomain-containing protein; homeodomain, prote 4e-10
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 4e-10
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 5e-10
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 1e-09
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 1e-09
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 1e-09
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 1e-09
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 1e-09
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-09
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 2e-09
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-09
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 3e-09
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 6e-09
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 6e-09
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 7e-09
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-08
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-08
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 2e-08
1e3o_C160 Octamer-binding transcription factor 1; transcript 2e-08
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 3e-08
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 3e-08
2xsd_C164 POU domain, class 3, transcription factor 1; trans 5e-08
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 9e-08
1uhs_A72 HOP, homeodomain only protein; structural genomics 1e-07
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 2e-07
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 3e-07
3d1n_I151 POU domain, class 6, transcription factor 1; prote 6e-07
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 7e-07
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 8e-07
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 8e-07
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 3e-06
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 4e-06
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 1e-05
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 1e-05
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 1e-05
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 1e-05
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 2e-05
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 2e-05
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 3e-05
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 3e-05
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 4e-05
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 5e-05
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 6e-05
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 7e-05
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 8e-05
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 8e-05
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 1e-04
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 2e-04
3a02_A60 Homeobox protein aristaless; homeodomain, developm 2e-04
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 3e-04
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 6e-04
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
 Score = 84.9 bits (211), Expect = 2e-22
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 18 KKKSKMKNKRRFSDEQIRLLESIFESESTKLEPRKKMQVATELGLQPRQVAIWFQNKRAR 77
          KK+   K K   S +    LE +F  +   L  ++K +VA + G+ P QV +WF NKR R
Sbjct: 1  KKEKSPKGKSSISPQARAFLEEVFRRKQ-SLNSKEKEEVAKKCGITPLQVRVWFINKRMR 59

Query: 78 WK 79
           K
Sbjct: 60 SK 61
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query195
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.81
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.8
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.79
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.79
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.79
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.79
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.78
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.78
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.78
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.78
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.78
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.78
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.78
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.78
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.78
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.78
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.78
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.77
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.77
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.77
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.77
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.77
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.77
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.76
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.76
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.76
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.76
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.76
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.76
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.76
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.76
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.75
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.75
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.75
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.75
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.75
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.75
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.75
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.75
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.75
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.74
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.74
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.73
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.73
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.72
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.72
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.72
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.72
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.72
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.71
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.71
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.7
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.7
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.7
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.69
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.69
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.69
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.69
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.69
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.68
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.68
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.67
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.67
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.67
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.67
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.66
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.66
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.65
2e19_A64 Transcription factor 8; homeobox domain, structura 99.64
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.63
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.62
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.61
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.46
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.44
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.39
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.35
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.28
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.72
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 95.17
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 93.2
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 91.65
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 90.67
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 89.17
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 89.16
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 88.39
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 87.57
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 85.93
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 85.65
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 85.29
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 84.2
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 84.0
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 83.66
2wt7_B90 Transcription factor MAFB; transcription, transcri 83.09
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 81.2
3m48_A33 General control protein GCN4; leucine zipper, synt 80.83
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.81  E-value=8.6e-20  Score=129.98  Aligned_cols=65  Identities=32%  Similarity=0.587  Sum_probs=60.1

Q ss_pred             hccCCCCCCCCCCCHHHHHHHHHHHhhcCCCCCHHHHHHHHHHhCCChhHHHHHHHhhHHHHHHHH
Q 029338           17 RKKKSKMKNKRRFSDEQIRLLESIFESESTKLEPRKKMQVATELGLQPRQVAIWFQNKRARWKSKQ   82 (195)
Q Consensus        17 ~~~kk~rr~R~~ft~eQ~~~Le~~F~~~~~~ps~~~r~~LA~~LgLt~rQVkvWFQNRRak~Krkq   82 (195)
                      ...++.++.|+.||.+|+.+||..|..+ +||+..++..||..|||++.||+|||||||+|+|+..
T Consensus        12 ~~~~~~rr~Rt~ft~~Q~~~Le~~F~~~-~yp~~~~r~~LA~~l~L~~~qV~vWFqNRR~k~kk~~   76 (80)
T 2dmt_A           12 TKAKKGRRSRTVFTELQLMGLEKRFEKQ-KYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKSG   76 (80)
T ss_dssp             CCCCCCCCSCCCCCHHHHHHHHHHHHHC-SSCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHSCCC
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHhc-CCCCHHHHHHHHHHhCCCHHHeeeccHHHHHHhhccc
Confidence            3455667889999999999999999999 9999999999999999999999999999999999853
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 195
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 1e-13
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 2e-13
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 4e-13
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 1e-12
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-12
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-12
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 2e-12
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 4e-12
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 4e-12
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 6e-12
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 1e-11
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-11
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 3e-11
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 3e-11
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 7e-11
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 8e-11
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 8e-11
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 1e-10
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 2e-10
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 3e-10
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 6e-10
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 7e-10
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 1e-09
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 1e-09
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 1e-09
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 2e-09
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 4e-08
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 6e-08
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 5e-07
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 6e-07
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 2e-06
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 1e-05
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeodomain-only protein, Hop
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 61.2 bits (148), Expect = 1e-13
 Identities = 14/59 (23%), Positives = 27/59 (45%)

Query: 24 KNKRRFSDEQIRLLESIFESESTKLEPRKKMQVATELGLQPRQVAIWFQNKRARWKSKQ 82
          +     +++Q+ +LE  F   +   +P     +A E GL   Q   WF+ + A W+  +
Sbjct: 3  EGAATMTEDQVEILEYNFNKVNKHPDPTTLCLIAAEAGLTEEQTQKWFKQRLAEWRRSE 61
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query195
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.82
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.82
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.82
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.82
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.82
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.82
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.81
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.81
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.8
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.8
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.79
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.78
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.78
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.78
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.78
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.77
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.76
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.76
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.75
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.74
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.73
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.73
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.69
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.68
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.68
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.67
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.66
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.64
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.62
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.6
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.55
d1hlva166 DNA-binding domain of centromere binding protein B 89.87
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 85.71
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 84.01
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein prh
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.82  E-value=9.9e-21  Score=125.87  Aligned_cols=57  Identities=40%  Similarity=0.708  Sum_probs=54.7

Q ss_pred             CCCCCCCCHHHHHHHHHHHhhcCCCCCHHHHHHHHHHhCCChhHHHHHHHhhHHHHHH
Q 029338           23 MKNKRRFSDEQIRLLESIFESESTKLEPRKKMQVATELGLQPRQVAIWFQNKRARWKS   80 (195)
Q Consensus        23 rr~R~~ft~eQ~~~Le~~F~~~~~~ps~~~r~~LA~~LgLt~rQVkvWFQNRRak~Kr   80 (195)
                      ++.|++||++|+.+||..|..+ +||+..++..||..|||+++||+|||||||+++||
T Consensus         1 k~~R~~ft~~Q~~~Le~~F~~n-~yp~~~~r~~LA~~l~L~~~qV~~WFqNrR~k~kk   57 (57)
T d2e1oa1           1 KGGQVRFSNDQTIELEKKFETQ-KYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRR   57 (57)
T ss_dssp             CCCCCCCCHHHHHHHHHHHHHC-SSCCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHH
T ss_pred             CCCCccCCHHHHHHHHHHHHhC-CCCCHHHHHHHHHHhCCCHHHhhHhhhhhhhhccC
Confidence            4578999999999999999999 99999999999999999999999999999999986
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure