Citrus Sinensis ID: 029363


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MATPQMLSSLKYSDSLTVVGISFCTAIICESISWLLIYRTNSYKTLKSSIDKASKKLETMKIENPAKISTKKSKTKKIDRVETSLKESSRDLSLFKFKSGAVVALVLFVVFGLLNSLFEGKVVAKLPFKPFGIVMKMSHRGLQGDDATDCSMAFLYFLCSISIRTNLQKFLGFSPPRGAAAGGGLFPMPDPKTN
ccccccccccccccccHHHHHHHHHHHHHHHHHHEEEEEcHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc
*********LKYSDSLTVVGISFCTAIICESISWLLIYRTNSYKTL*********************************************LSLFKFKSGAVVALVLFVVFGLLNSLFEGKVVAKLPFKPFGIVMKMSHRGLQGDDATDCSMAFLYFLCSISIRTNLQKFLGFS********************
xxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATPQMLSSLKYSDSLTVVGISFCTAIICESISWLLIYRTNSxxxxxxxxxxxxxxxxxxxxxNPAKISTKKSKTKKIDRVETSLKESSRDLSLFKFKSGAVVALVLFVVFGLLNSLFEGKVVAKLPFKPFGIVMKMSHRGLQGDDATDCSMAFLYFLCSISIRTNLQKFLGFSPPRGAAAGGGLFPMPDPKTN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transmembrane and coiled-coil domain-containing protein 1 probableQ3T0N3
Transmembrane and coiled-coil domains protein 1 probableC5HGF3
Transmembrane and coiled-coil domain-containing protein 1 probableQ9UM00

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LF0, chain A
Confidence level:probable
Coverage over the Query: 41-78
View the alignment between query and template
View the model in PyMOL