Citrus Sinensis ID: 029398


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MFQVLYLINFAPFSRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKANTNTNNNNNSDDHKQNSKATTAHDHQSAESAMSPQASSSSDELSSVTTGETNNNNNSDRYCMDKYVKGDHEQNVDSFESFPVIDESFWTDTSLSENSSNLTSDFGGGLNEFAIGHHDYGGGMDFWYNILVTSGADSLTLPF
ccHHHHHHHHHcccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccc
ccEEEEEEEHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccc
MFQVLYLInfapfsrwsaiagrlpgrtdneiKNVWHTHLKKKAAAVLKQNQKantntnnnnnsddhkqnskattahdhqsaesamspqassssdelssvttgetnnnnnsdrycmdkyvkgdheqnvdsfesfpvidesfwtdtslsenssnltsdfggglnefaighhdygggmDFWYNILVTsgadsltlpf
MFQVLYLInfapfsrwSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKantntnnnnnsddhKQNSKATTAHDHQSAESAMSPQASSSSDELSsvttgetnnnnnsdrYCMDKYVKGDHEQNVDSFESFPVIDESFWTDTSLSENSSNLTSDFGGGLNEFAIGHHDYGGGMDFWYNILVTSGADSLTLPF
MFQVLYLINFAPFSRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKAntntnnnnnSDDHKQNSKATTAHDHQsaesamspqassssdelssVTTGETNNNNNSDRYCMDKYVKGDHEQNVDSFESFPVIDESFWTdtslsenssnltsdFGGGLNEFAIGHHDYGGGMDFWYNILVTSGADSLTLPF
*********************************************************************************************************************YV********DSFESFPVIDESFWTDT*********TSDFGGGLNEFAIGHHDYGGGMDFWYNILVTSG********
MFQVLYLINFAPFSRWSAIAGRLPGRTDNEIKNVWHTHL*********************************************************************************************FPVIDESFWTDTSLSENSSN****************HDYGGGMDFWYNILVTSGADSLTLPF
MFQVLYLINFAPFSRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKANTNTNNNNN*****************************************TNNNNNSDRYCMDKYVKGDHEQNVDSFESFPVIDESFWTDTSLSENSSNLTSDFGGGLNEFAIGHHDYGGGMDFWYNILVTSGADSLTLPF
MFQVLYLINFAPFSRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAV*****************************************************************************************I**SF********************************GGMDFWYNILVTSGADSLTLPF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFQVLYLINFAPFSRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKANTNTNNNNNSDDHKQNSKATTAHDHQSAESAMSPQASSSSDELSSVTTGETNNNNNSDRYCMDKYVKGDHEQNVDSFESFPVIDESFWTDTSLSENSSNLTSDFGGGLNEFAIGHHDYGGGMDFWYNILVTSGADSLTLPF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query194 2.2.26 [Sep-21-2011]
Q7XBH4257 Myb-related protein Myb4 no no 0.144 0.108 0.928 1e-09
Q38850249 Transcription repressor M no no 0.438 0.341 0.378 8e-09
Q9FJA2258 Transcription factor TT2 no no 0.247 0.186 0.571 4e-08
P20024340 Myb-related protein Zm1 O N/A no 0.221 0.126 0.577 7e-08
Q38851236 Transcription repressor M no no 0.206 0.169 0.575 2e-07
Q53NK6237 Myb-related protein MYBAS no no 0.149 0.122 0.793 2e-07
Q4JL76242 Myb-related protein MYBAS no no 0.149 0.119 0.793 3e-07
Q50EX6294 Protein ODORANT1 OS=Petun N/A no 0.273 0.180 0.484 3e-07
Q9S9K9257 Transcription factor MYB3 no no 0.144 0.108 0.785 3e-07
Q9LTF7201 Transcription factor MYB8 no no 0.149 0.144 0.793 3e-07
>sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 Back     alignment and function desciption
 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/28 (92%), Positives = 27/28 (96%)

Query: 15  RWSAIAGRLPGRTDNEIKNVWHTHLKKK 42
           RWSAIA RLPGRTDNEIKNVWHTHLKK+
Sbjct: 88  RWSAIAARLPGRTDNEIKNVWHTHLKKR 115




Putative transcription factor which is may be involved in cold stress response.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q38850|MYB5_ARATH Transcription repressor MYB5 OS=Arabidopsis thaliana GN=MYB5 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJA2|TT2_ARATH Transcription factor TT2 OS=Arabidopsis thaliana GN=TT2 PE=1 SV=1 Back     alignment and function description
>sp|P20024|MYB1_MAIZE Myb-related protein Zm1 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 Back     alignment and function description
>sp|Q53NK6|MYBA1_ORYSJ Myb-related protein MYBAS1 OS=Oryza sativa subsp. japonica GN=MYBAS1 PE=2 SV=1 Back     alignment and function description
>sp|Q4JL76|MYBA2_ORYSJ Myb-related protein MYBAS2 OS=Oryza sativa subsp. japonica GN=MYBAS2 PE=2 SV=1 Back     alignment and function description
>sp|Q50EX6|ODO1_PETHY Protein ODORANT1 OS=Petunia hybrida GN=ODO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LTF7|MYB82_ARATH Transcription factor MYB82 OS=Arabidopsis thaliana GN=MYB82 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
224099907287 predicted protein [Populus trichocarpa] 0.804 0.543 0.406 1e-21
22266675253 myb-related transcription factor VlMYBB1 0.778 0.596 0.375 1e-19
327412635272 putative MYB transcription factor [Rosa 0.845 0.602 0.370 1e-18
356498363264 PREDICTED: myb-related protein Myb4-like 0.788 0.579 0.348 2e-18
5139806264 GmMYB29A2 [Glycine max] 0.788 0.579 0.348 2e-18
217337738238 myb-related transcription factor [Panax 0.706 0.575 0.398 2e-18
156147383278 myb-related transcription factor [Datura 0.829 0.579 0.396 2e-18
6552359281 myb-related transcription factor LBM1 [N 0.865 0.597 0.399 2e-17
359806618272 uncharacterized protein LOC100807569 [Gl 0.824 0.588 0.33 2e-17
297831064285 AtMYB15/AtY19/MYB15 [Arabidopsis lyrata 0.871 0.592 0.382 3e-17
>gi|224099907|ref|XP_002311670.1| predicted protein [Populus trichocarpa] gi|222851490|gb|EEE89037.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 80/197 (40%), Positives = 104/197 (52%), Gaps = 41/197 (20%)

Query: 15  RWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKANT-------NTNNNNNSDDHK 67
           RWSAIA RLPGRTDNEIKNVWHTHL K+    LKQN +  +       + + N+N     
Sbjct: 88  RWSAIASRLPGRTDNEIKNVWHTHLLKR----LKQNGEPKSQQHIRIPDCHLNDNKLSQS 143

Query: 68  QNSKATTAHDHQSAESA-MSPQASS---SSDELSSVTTGETNNNNNSDRYCMDKYVKGDH 123
            NS   +    +S E A +SPQ SS   SS   +SVTT ETNN            +K   
Sbjct: 144 ANSTIPSLSGCKSIEYAQISPQPSSSDHSSVTDTSVTTSETNNTG---------LIKV-- 192

Query: 124 EQNVDSFESFPVIDESFWTDTSLSENSSNLTSDFGGGLNEFAIGHHD-------YGGG-- 174
            +N+DS E +PVIDE FW++  + ENS   +S+F    ++F     D       YG G  
Sbjct: 193 -ENIDSSEIYPVIDEDFWSEPEMVENSGMPSSNFLDD-SQFPFPSPDTMERAGCYGYGPK 250

Query: 175 ----MDFWYNILVTSGA 187
               M+FWYN+ + SG 
Sbjct: 251 VDDNMEFWYNLFIKSGG 267




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|22266675|dbj|BAC07544.1| myb-related transcription factor VlMYBB1-2 [Vitis labrusca x Vitis vinifera] Back     alignment and taxonomy information
>gi|327412635|emb|CCA29106.1| putative MYB transcription factor [Rosa rugosa] Back     alignment and taxonomy information
>gi|356498363|ref|XP_003518022.1| PREDICTED: myb-related protein Myb4-like [Glycine max] Back     alignment and taxonomy information
>gi|5139806|dbj|BAA81732.1| GmMYB29A2 [Glycine max] Back     alignment and taxonomy information
>gi|217337738|gb|ACK43221.1| myb-related transcription factor [Panax ginseng] Back     alignment and taxonomy information
>gi|156147383|gb|ABU53925.1| myb-related transcription factor [Datura metel] Back     alignment and taxonomy information
>gi|6552359|dbj|BAA88221.1| myb-related transcription factor LBM1 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|359806618|ref|NP_001241018.1| uncharacterized protein LOC100807569 [Glycine max] gi|5139814|dbj|BAA81736.1| GmMYB29B2 [Glycine max] gi|255642060|gb|ACU21296.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297831064|ref|XP_002883414.1| AtMYB15/AtY19/MYB15 [Arabidopsis lyrata subsp. lyrata] gi|297329254|gb|EFH59673.1| AtMYB15/AtY19/MYB15 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
TAIR|locus:2042526249 MYB14 "myb domain protein 14" 0.149 0.116 0.862 9.8e-17
TAIR|locus:2038520246 MYB13 "myb domain protein 13" 0.319 0.252 0.483 8.9e-15
TAIR|locus:2086233285 MYB15 "myb domain protein 15" 0.634 0.431 0.359 7.6e-12
TAIR|locus:2098906299 MYB17 "myb domain protein 17" 0.149 0.096 0.758 2.9e-10
TAIR|locus:2205283282 MYB20 "myb domain protein 20" 0.149 0.102 0.758 1.7e-09
TAIR|locus:2032860274 MYB58 "myb domain protein 58" 0.293 0.208 0.438 2.1e-09
TAIR|locus:2207330294 MYB63 "myb domain protein 63" 0.159 0.105 0.774 3.4e-09
TAIR|locus:504955052201 MYB82 "myb domain protein 82" 0.149 0.144 0.793 3.6e-09
TAIR|locus:2092820249 MYB5 "myb domain protein 5" [A 0.149 0.116 0.793 5.5e-09
TAIR|locus:2019185330 MYB31 "myb domain protein 31" 0.190 0.112 0.621 5.6e-09
TAIR|locus:2042526 MYB14 "myb domain protein 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 146 (56.5 bits), Expect = 9.8e-17, Sum P(3) = 9.8e-17
 Identities = 25/29 (86%), Positives = 28/29 (96%)

Query:    14 SRWSAIAGRLPGRTDNEIKNVWHTHLKKK 42
             +RWSAIA +LPGRTDNEIKNVWHTHLKK+
Sbjct:    87 NRWSAIAAKLPGRTDNEIKNVWHTHLKKR 115


GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0009651 "response to salt stress" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=IEP
GO:0009733 "response to auxin stimulus" evidence=IEP
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP
TAIR|locus:2038520 MYB13 "myb domain protein 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086233 MYB15 "myb domain protein 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098906 MYB17 "myb domain protein 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205283 MYB20 "myb domain protein 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032860 MYB58 "myb domain protein 58" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207330 MYB63 "myb domain protein 63" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955052 MYB82 "myb domain protein 82" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092820 MYB5 "myb domain protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019185 MYB31 "myb domain protein 31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 3e-11
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 6e-09
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 3e-06
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 1e-04
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 2e-04
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information
 Score = 60.1 bits (145), Expect = 3e-11
 Identities = 36/96 (37%), Positives = 58/96 (60%), Gaps = 10/96 (10%)

Query: 14  SRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKANTNTNNNNNSDDHKQNSKAT 73
           +RWS IAGR+PGRTDNEIKN W+THL+KK   +L+Q     T+   + N + HK   + +
Sbjct: 98  NRWSLIAGRIPGRTDNEIKNYWNTHLRKK---LLRQGIDPQTHKPLDAN-NIHKPEEEVS 153

Query: 74  TAHDHQSAESAMSPQASSSSDELSSVTTGETNNNNN 109
               +      + P +SS +D+ ++V  G+ ++ N+
Sbjct: 154 GGQKY-----PIEPISSSHTDD-TTVNGGDGDSKNS 183


Length = 249

>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 194
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.43
PLN03212249 Transcription repressor MYB5; Provisional 99.16
PLN03091 459 hypothetical protein; Provisional 99.05
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 98.63
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.56
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.51
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.39
PLN03212249 Transcription repressor MYB5; Provisional 97.92
KOG0048238 consensus Transcription factor, Myb superfamily [T 97.73
PLN03091 459 hypothetical protein; Provisional 97.55
KOG0049 939 consensus Transcription factor, Myb superfamily [T 95.15
COG5147 512 REB1 Myb superfamily proteins, including transcrip 94.93
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 94.76
COG5147 512 REB1 Myb superfamily proteins, including transcrip 93.97
KOG0051607 consensus RNA polymerase I termination factor, Myb 91.34
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 89.09
KOG0049 939 consensus Transcription factor, Myb superfamily [T 87.66
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 80.57
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
Probab=99.43  E-value=1.1e-13  Score=118.92  Aligned_cols=45  Identities=56%  Similarity=0.870  Sum_probs=41.7

Q ss_pred             HHHHHHHHccCCCHHHHhccCCCCChHHHHHHHHHhhHhhHHHHHHhcC
Q 029398            3 QVLYLINFAPFSRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQ   51 (194)
Q Consensus         3 ~lLi~l~~e~GnkWs~IA~~LpGRTdn~IKNrW~~~Lrkr~~~~lk~~~   51 (194)
                      ++|+++|+.+||||+.||++|||||||+|||+|+++|+||    +....
T Consensus        71 ~~Ii~lH~~~GNrWs~IA~~LPGRTDNeIKN~Wnt~lkkk----l~~~~  115 (238)
T KOG0048|consen   71 DLIIKLHALLGNRWSLIAGRLPGRTDNEVKNHWNTHLKKK----LLKMG  115 (238)
T ss_pred             HHHHHHHHHHCcHHHHHHhhCCCcCHHHHHHHHHHHHHHH----HHHcC
Confidence            6899999999999999999999999999999999999999    65544



>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 7e-04
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure

Iteration: 1

Score = 40.4 bits (93), Expect = 7e-04, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 28/40 (70%) Query: 3 QVLYLINFAPFSRWSAIAGRLPGRTDNEIKNVWHTHLKKK 42 ++LY + +RW+ IA LPGRTDN IKN W++ +++K Sbjct: 14 RILYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRK 53

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 2e-17
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 9e-16
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 2e-15
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 4e-13
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 5e-12
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 9e-12
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
 Score = 73.5 bits (181), Expect = 2e-17
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 15  RWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKANTNTNNNNNSDD 65
           +WS IA  +PGRTDN IKN W++ + K+ +      +    + +    + D
Sbjct: 75  KWSVIAKLIPGRTDNAIKNRWNSSISKRISTNSNHKEILLPDRSKKRKAAD 125


>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.26
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.1
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.09
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.08
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.07
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.05
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.05
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.03
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.02
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.59
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.02
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.01
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 98.95
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.95
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 98.94
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 98.93
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 98.86
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.84
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 98.79
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 98.78
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 98.74
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.73
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.61
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.58
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 98.51
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.48
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.42
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.42
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.42
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.39
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.38
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.29
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 98.29
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.16
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.13
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.82
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 97.76
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 97.74
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 97.7
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 96.73
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.16
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 96.11
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 94.79
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 95.58
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 93.92
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 93.09
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 92.94
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 91.57
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 91.53
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 88.93
2crg_A70 Metastasis associated protein MTA3; transcription 87.97
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
Probab=99.26  E-value=3.1e-12  Score=90.51  Aligned_cols=40  Identities=20%  Similarity=0.154  Sum_probs=38.5

Q ss_pred             HHHHHHHHccCCCHHHHhccCCCCChHHHHHHHHHhhHhh
Q 029398            3 QVLYLINFAPFSRWSAIAGRLPGRTDNEIKNVWHTHLKKK   42 (194)
Q Consensus         3 ~lLi~l~~e~GnkWs~IA~~LpGRTdn~IKNrW~~~Lrkr   42 (194)
                      ++|+++|.+||++|..||++|||||+++||+||+.+++++
T Consensus        18 ~~l~~~~~~~G~~W~~Ia~~~~~Rt~~q~k~r~~~~l~~~   57 (72)
T 2cu7_A           18 ELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNK   57 (72)
T ss_dssp             HHHHHHHHHTCSCHHHHHHHHSSSCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHCcCHHHHHHHcCCCCHHHHHHHHHHHHHHH
Confidence            5899999999999999999999999999999999999888



>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 194
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 2e-07
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 9e-07
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 8e-06
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-05
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 8e-05
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-04
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-04
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 0.003
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 43.7 bits (103), Expect = 2e-07
 Identities = 15/27 (55%), Positives = 21/27 (77%)

Query: 14 SRWSAIAGRLPGRTDNEIKNVWHTHLK 40
          +RW+ IA  LPGRTDN IKN W++ ++
Sbjct: 21 NRWAEIAKLLPGRTDNAIKNHWNSTMR 47


>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.42
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 98.99
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.97
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.94
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 98.91
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 98.66
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 98.62
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 98.58
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 98.57
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.49
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.46
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.37
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.36
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.36
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 95.05
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 93.68
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 86.91
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 80.85
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.42  E-value=4.8e-14  Score=91.89  Aligned_cols=38  Identities=42%  Similarity=0.803  Sum_probs=36.2

Q ss_pred             HHHHHHHHccCCCHHHHhccCCCCChHHHHHHHHHhhH
Q 029398            3 QVLYLINFAPFSRWSAIAGRLPGRTDNEIKNVWHTHLK   40 (194)
Q Consensus         3 ~lLi~l~~e~GnkWs~IA~~LpGRTdn~IKNrW~~~Lr   40 (194)
                      ++|+++|+++|++|+.||++|||||+++|||||+.+||
T Consensus        10 ~~L~~~v~~~G~~W~~Ia~~~~gRt~~~~knr~~~~lr   47 (47)
T d1gv2a2          10 RIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMR   47 (47)
T ss_dssp             HHHHHHHHHHSSCHHHHHTTCTTCCHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHhhHHHHHHhHcCCCCHHHHHHHHHHHcC
Confidence            68999999999999999999999999999999999875



>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure