Citrus Sinensis ID: 029398
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 194 | ||||||
| 224099907 | 287 | predicted protein [Populus trichocarpa] | 0.804 | 0.543 | 0.406 | 1e-21 | |
| 22266675 | 253 | myb-related transcription factor VlMYBB1 | 0.778 | 0.596 | 0.375 | 1e-19 | |
| 327412635 | 272 | putative MYB transcription factor [Rosa | 0.845 | 0.602 | 0.370 | 1e-18 | |
| 356498363 | 264 | PREDICTED: myb-related protein Myb4-like | 0.788 | 0.579 | 0.348 | 2e-18 | |
| 5139806 | 264 | GmMYB29A2 [Glycine max] | 0.788 | 0.579 | 0.348 | 2e-18 | |
| 217337738 | 238 | myb-related transcription factor [Panax | 0.706 | 0.575 | 0.398 | 2e-18 | |
| 156147383 | 278 | myb-related transcription factor [Datura | 0.829 | 0.579 | 0.396 | 2e-18 | |
| 6552359 | 281 | myb-related transcription factor LBM1 [N | 0.865 | 0.597 | 0.399 | 2e-17 | |
| 359806618 | 272 | uncharacterized protein LOC100807569 [Gl | 0.824 | 0.588 | 0.33 | 2e-17 | |
| 297831064 | 285 | AtMYB15/AtY19/MYB15 [Arabidopsis lyrata | 0.871 | 0.592 | 0.382 | 3e-17 |
| >gi|224099907|ref|XP_002311670.1| predicted protein [Populus trichocarpa] gi|222851490|gb|EEE89037.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 108 bits (270), Expect = 1e-21, Method: Compositional matrix adjust.
Identities = 80/197 (40%), Positives = 104/197 (52%), Gaps = 41/197 (20%)
Query: 15 RWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKANT-------NTNNNNNSDDHK 67
RWSAIA RLPGRTDNEIKNVWHTHL K+ LKQN + + + + N+N
Sbjct: 88 RWSAIASRLPGRTDNEIKNVWHTHLLKR----LKQNGEPKSQQHIRIPDCHLNDNKLSQS 143
Query: 68 QNSKATTAHDHQSAESA-MSPQASS---SSDELSSVTTGETNNNNNSDRYCMDKYVKGDH 123
NS + +S E A +SPQ SS SS +SVTT ETNN +K
Sbjct: 144 ANSTIPSLSGCKSIEYAQISPQPSSSDHSSVTDTSVTTSETNNTG---------LIKV-- 192
Query: 124 EQNVDSFESFPVIDESFWTDTSLSENSSNLTSDFGGGLNEFAIGHHD-------YGGG-- 174
+N+DS E +PVIDE FW++ + ENS +S+F ++F D YG G
Sbjct: 193 -ENIDSSEIYPVIDEDFWSEPEMVENSGMPSSNFLDD-SQFPFPSPDTMERAGCYGYGPK 250
Query: 175 ----MDFWYNILVTSGA 187
M+FWYN+ + SG
Sbjct: 251 VDDNMEFWYNLFIKSGG 267
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|22266675|dbj|BAC07544.1| myb-related transcription factor VlMYBB1-2 [Vitis labrusca x Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|327412635|emb|CCA29106.1| putative MYB transcription factor [Rosa rugosa] | Back alignment and taxonomy information |
|---|
| >gi|356498363|ref|XP_003518022.1| PREDICTED: myb-related protein Myb4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|5139806|dbj|BAA81732.1| GmMYB29A2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|217337738|gb|ACK43221.1| myb-related transcription factor [Panax ginseng] | Back alignment and taxonomy information |
|---|
| >gi|156147383|gb|ABU53925.1| myb-related transcription factor [Datura metel] | Back alignment and taxonomy information |
|---|
| >gi|6552359|dbj|BAA88221.1| myb-related transcription factor LBM1 [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|359806618|ref|NP_001241018.1| uncharacterized protein LOC100807569 [Glycine max] gi|5139814|dbj|BAA81736.1| GmMYB29B2 [Glycine max] gi|255642060|gb|ACU21296.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297831064|ref|XP_002883414.1| AtMYB15/AtY19/MYB15 [Arabidopsis lyrata subsp. lyrata] gi|297329254|gb|EFH59673.1| AtMYB15/AtY19/MYB15 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 194 | ||||||
| TAIR|locus:2042526 | 249 | MYB14 "myb domain protein 14" | 0.149 | 0.116 | 0.862 | 9.8e-17 | |
| TAIR|locus:2038520 | 246 | MYB13 "myb domain protein 13" | 0.319 | 0.252 | 0.483 | 8.9e-15 | |
| TAIR|locus:2086233 | 285 | MYB15 "myb domain protein 15" | 0.634 | 0.431 | 0.359 | 7.6e-12 | |
| TAIR|locus:2098906 | 299 | MYB17 "myb domain protein 17" | 0.149 | 0.096 | 0.758 | 2.9e-10 | |
| TAIR|locus:2205283 | 282 | MYB20 "myb domain protein 20" | 0.149 | 0.102 | 0.758 | 1.7e-09 | |
| TAIR|locus:2032860 | 274 | MYB58 "myb domain protein 58" | 0.293 | 0.208 | 0.438 | 2.1e-09 | |
| TAIR|locus:2207330 | 294 | MYB63 "myb domain protein 63" | 0.159 | 0.105 | 0.774 | 3.4e-09 | |
| TAIR|locus:504955052 | 201 | MYB82 "myb domain protein 82" | 0.149 | 0.144 | 0.793 | 3.6e-09 | |
| TAIR|locus:2092820 | 249 | MYB5 "myb domain protein 5" [A | 0.149 | 0.116 | 0.793 | 5.5e-09 | |
| TAIR|locus:2019185 | 330 | MYB31 "myb domain protein 31" | 0.190 | 0.112 | 0.621 | 5.6e-09 |
| TAIR|locus:2042526 MYB14 "myb domain protein 14" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 146 (56.5 bits), Expect = 9.8e-17, Sum P(3) = 9.8e-17
Identities = 25/29 (86%), Positives = 28/29 (96%)
Query: 14 SRWSAIAGRLPGRTDNEIKNVWHTHLKKK 42
+RWSAIA +LPGRTDNEIKNVWHTHLKK+
Sbjct: 87 NRWSAIAAKLPGRTDNEIKNVWHTHLKKR 115
|
|
| TAIR|locus:2038520 MYB13 "myb domain protein 13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2086233 MYB15 "myb domain protein 15" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098906 MYB17 "myb domain protein 17" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2205283 MYB20 "myb domain protein 20" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2032860 MYB58 "myb domain protein 58" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2207330 MYB63 "myb domain protein 63" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504955052 MYB82 "myb domain protein 82" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2092820 MYB5 "myb domain protein 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2019185 MYB31 "myb domain protein 31" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 194 | |||
| PLN03212 | 249 | PLN03212, PLN03212, Transcription repressor MYB5; | 3e-11 | |
| PLN03091 | 459 | PLN03091, PLN03091, hypothetical protein; Provisio | 6e-09 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 3e-06 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 1e-04 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 2e-04 |
| >gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
Score = 60.1 bits (145), Expect = 3e-11
Identities = 36/96 (37%), Positives = 58/96 (60%), Gaps = 10/96 (10%)
Query: 14 SRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKANTNTNNNNNSDDHKQNSKAT 73
+RWS IAGR+PGRTDNEIKN W+THL+KK +L+Q T+ + N + HK + +
Sbjct: 98 NRWSLIAGRIPGRTDNEIKNYWNTHLRKK---LLRQGIDPQTHKPLDAN-NIHKPEEEVS 153
Query: 74 TAHDHQSAESAMSPQASSSSDELSSVTTGETNNNNN 109
+ + P +SS +D+ ++V G+ ++ N+
Sbjct: 154 GGQKY-----PIEPISSSHTDD-TTVNGGDGDSKNS 183
|
Length = 249 |
| >gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 194 | |||
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 99.43 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 99.16 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 99.05 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 98.63 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 98.56 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 98.51 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 98.39 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 97.92 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 97.73 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 97.55 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 95.15 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 94.93 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 94.76 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 93.97 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 91.34 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 89.09 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 87.66 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 80.57 |
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
Probab=99.43 E-value=1.1e-13 Score=118.92 Aligned_cols=45 Identities=56% Similarity=0.870 Sum_probs=41.7
Q ss_pred HHHHHHHHccCCCHHHHhccCCCCChHHHHHHHHHhhHhhHHHHHHhcC
Q 029398 3 QVLYLINFAPFSRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQ 51 (194)
Q Consensus 3 ~lLi~l~~e~GnkWs~IA~~LpGRTdn~IKNrW~~~Lrkr~~~~lk~~~ 51 (194)
++|+++|+.+||||+.||++|||||||+|||+|+++|+|| +....
T Consensus 71 ~~Ii~lH~~~GNrWs~IA~~LPGRTDNeIKN~Wnt~lkkk----l~~~~ 115 (238)
T KOG0048|consen 71 DLIIKLHALLGNRWSLIAGRLPGRTDNEVKNHWNTHLKKK----LLKMG 115 (238)
T ss_pred HHHHHHHHHHCcHHHHHHhhCCCcCHHHHHHHHHHHHHHH----HHHcC
Confidence 6899999999999999999999999999999999999999 65544
|
|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 194 | ||||
| 1idy_A | 54 | Structure Of Myb Transforming Protein, Nmr, Minimiz | 7e-04 |
| >pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 194 | |||
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 2e-17 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 9e-16 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 2e-15 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 4e-13 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 5e-12 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 9e-12 |
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 | Back alignment and structure |
|---|
Score = 73.5 bits (181), Expect = 2e-17
Identities = 16/51 (31%), Positives = 27/51 (52%)
Query: 15 RWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKANTNTNNNNNSDD 65
+WS IA +PGRTDN IKN W++ + K+ + + + + + D
Sbjct: 75 KWSVIAKLIPGRTDNAIKNRWNSSISKRISTNSNHKEILLPDRSKKRKAAD 125
|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 194 | |||
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.26 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.1 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.09 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.08 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.07 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.05 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.05 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.03 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.02 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 98.59 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.02 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.01 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 98.95 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 98.95 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 98.94 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 98.93 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 98.86 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 98.84 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 98.79 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 98.78 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 98.74 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 98.73 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 98.61 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 98.58 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 98.51 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 98.48 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 98.42 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 98.42 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 98.42 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 98.39 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 98.38 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 98.29 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 98.29 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 98.16 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 98.13 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.82 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 97.76 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 97.74 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 97.7 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 96.73 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 96.16 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 96.11 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 94.79 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 95.58 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 93.92 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 93.09 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 92.94 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 91.57 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 91.53 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 88.93 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 87.97 |
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
Probab=99.26 E-value=3.1e-12 Score=90.51 Aligned_cols=40 Identities=20% Similarity=0.154 Sum_probs=38.5
Q ss_pred HHHHHHHHccCCCHHHHhccCCCCChHHHHHHHHHhhHhh
Q 029398 3 QVLYLINFAPFSRWSAIAGRLPGRTDNEIKNVWHTHLKKK 42 (194)
Q Consensus 3 ~lLi~l~~e~GnkWs~IA~~LpGRTdn~IKNrW~~~Lrkr 42 (194)
++|+++|.+||++|..||++|||||+++||+||+.+++++
T Consensus 18 ~~l~~~~~~~G~~W~~Ia~~~~~Rt~~q~k~r~~~~l~~~ 57 (72)
T 2cu7_A 18 ELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNK 57 (72)
T ss_dssp HHHHHHHHHTCSCHHHHHHHHSSSCHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHCcCHHHHHHHcCCCCHHHHHHHHHHHHHHH
Confidence 5899999999999999999999999999999999999888
|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 194 | ||||
| d1gv2a2 | 47 | a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou | 2e-07 | |
| d1igna1 | 86 | a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba | 9e-07 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 8e-06 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 2e-05 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 8e-05 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 1e-04 | |
| d1gvda_ | 52 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 2e-04 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 0.003 |
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: c-Myb, DNA-binding domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 43.7 bits (103), Expect = 2e-07
Identities = 15/27 (55%), Positives = 21/27 (77%)
Query: 14 SRWSAIAGRLPGRTDNEIKNVWHTHLK 40
+RW+ IA LPGRTDN IKN W++ ++
Sbjct: 21 NRWAEIAKLLPGRTDNAIKNHWNSTMR 47
|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 194 | |||
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.42 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 98.99 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.97 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.94 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 98.91 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 98.66 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 98.62 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 98.58 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 98.57 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 98.49 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 98.46 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 98.37 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 98.36 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 98.36 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 95.05 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 93.68 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 86.91 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 80.85 |
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: c-Myb, DNA-binding domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.42 E-value=4.8e-14 Score=91.89 Aligned_cols=38 Identities=42% Similarity=0.803 Sum_probs=36.2
Q ss_pred HHHHHHHHccCCCHHHHhccCCCCChHHHHHHHHHhhH
Q 029398 3 QVLYLINFAPFSRWSAIAGRLPGRTDNEIKNVWHTHLK 40 (194)
Q Consensus 3 ~lLi~l~~e~GnkWs~IA~~LpGRTdn~IKNrW~~~Lr 40 (194)
++|+++|+++|++|+.||++|||||+++|||||+.+||
T Consensus 10 ~~L~~~v~~~G~~W~~Ia~~~~gRt~~~~knr~~~~lr 47 (47)
T d1gv2a2 10 RIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMR 47 (47)
T ss_dssp HHHHHHHHHHSSCHHHHHTTCTTCCHHHHHHHHHHHTC
T ss_pred HHHHHHHHHHhhHHHHHHhHcCCCCHHHHHHHHHHHcC
Confidence 68999999999999999999999999999999999875
|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|