Citrus Sinensis ID: 029400

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISACTGNVNGGNIYEPKCSFVSPKPTRLSPRDGSVVEDEEDYLDLLFLPAQPAPKLWCRVNFCTCLQYTFP
ccHHHHHHHHHHHHHHHHHHccccccccEEEEccccccccHHHHHHHHHHHHHccccccccccEEEccccccccccccccHHHHHHHcccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHcHHHHHHHcccccccccccEEEEEcccccccccc
cccHHHHHHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHcccccccEEEEEEEEEEcccEcccccccccEEEHHcHHEEcHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccccccccccHHEEEEEEcccccHHHHHHcccccccccccc
MNDTLSATQIYHFLRKWLIVHSdflanplyiagdsysgkiVPIVVQEIsdgidaghkprmnlkgymlgnpvtddkidqnSKIQFAYLNALITYEIYKSAKknckgdyvnvdpgnylckadlqnisactgnvnggniyepkcsfvspkptrlsprdgsvvedeedyldllflpaqpapklwcrvnfctclqytfp
MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISACTGNVNGGNIYEPKcsfvspkptrlsprDGSVVEDEEDYLDLLFLPAQPAPKLWCRVNFCTCLQYTFP
MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISACTGNVNGGNIYEPKCSFVSPKPTRLSPRDGSVVedeedyldllFLPAQPAPKLWCRVNFCTCLQYTFP
******ATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISACTGNVNGGNIYEPKCSFV******************EDYLDLLFLPAQPAPKLWCRVNFCTCLQYTF*
MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISACTGNVNGGNIYEPKCSFVSP*************EDEEDYLDLLFLPAQPAPKLWCRVNFCTCLQYTFP
MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISACTGNVNGGNIYEPKCSFVSP**************DEEDYLDLLFLPAQPAPKLWCRVNFCTCLQYTFP
MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISACTGNVNGGNIYEPKCSFVSPKPTRLSPRDGSVVEDEEDYLDLLFLPAQPAPKLWCRVNFCTCLQYTFP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISACTGNVNGGNIYEPKCSFVSPKPTRLSPRDGSVVEDEEDYLDLLFLPAQPAPKLWCRVNFCTCLQYTFP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query194 2.2.26 [Sep-21-2011]
Q9C7Z9 464 Serine carboxypeptidase-l yes no 0.757 0.316 0.469 5e-35
Q9CAU0 452 Serine carboxypeptidase-l no no 0.747 0.320 0.489 4e-33
Q9C7D4435 Serine carboxypeptidase-l no no 0.747 0.333 0.468 4e-33
Q9C7D6437 Serine carboxypeptidase-l no no 0.737 0.327 0.454 3e-32
Q9CAU3441 Serine carboxypeptidase-l no no 0.747 0.328 0.475 4e-32
O81009435 Serine carboxypeptidase-l no no 0.747 0.333 0.475 5e-32
Q9CAU1441 Serine carboxypeptidase-l no no 0.747 0.328 0.462 8e-31
Q8VZU3 465 Serine carboxypeptidase-l no no 0.721 0.301 0.435 2e-30
Q8RWJ6441 Serine carboxypeptidase-l no no 0.747 0.328 0.462 4e-30
Q9SQX6437 Serine carboxypeptidase-l no no 0.747 0.331 0.448 4e-30
>sp|Q9C7Z9|SCP18_ARATH Serine carboxypeptidase-like 18 OS=Arabidopsis thaliana GN=SCPL18 PE=2 SV=2 Back     alignment and function desciption
 Score =  147 bits (370), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 69/147 (46%), Positives = 98/147 (66%)

Query: 2   NDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMN 61
           +DT  A Q Y FL+KWL+ +  F++NP+Y+ GDSY+G +VP +VQ+IS G + G+KP++N
Sbjct: 147 SDTGEAKQTYEFLQKWLVENPQFVSNPIYVGGDSYAGIVVPAIVQQISIGNEHGYKPQIN 206

Query: 62  LKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADL 121
           LKGY+LGNP TD   D NSKI +A+   LI+ E+Y+S K+ C+G+YV VDP N  C   +
Sbjct: 207 LKGYILGNPSTDLDSDHNSKIPYAHRMGLISDELYESLKRTCQGNYVKVDPTNTKCLKLM 266

Query: 122 QNISACTGNVNGGNIYEPKCSFVSPKP 148
           ++   C   +N G I    C   SP P
Sbjct: 267 EDYGKCVSRINEGLILIALCDLASPNP 293
Probable carboxypeptidase.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: -
>sp|Q9CAU0|SCP6_ARATH Serine carboxypeptidase-like 6 OS=Arabidopsis thaliana GN=SCPL6 PE=2 SV=2 Back     alignment and function description
>sp|Q9C7D4|SCP16_ARATH Serine carboxypeptidase-like 16 OS=Arabidopsis thaliana GN=SCPL16 PE=2 SV=1 Back     alignment and function description
>sp|Q9C7D6|SCP17_ARATH Serine carboxypeptidase-like 17 OS=Arabidopsis thaliana GN=SCPL17 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAU3|SCP2_ARATH Serine carboxypeptidase-like 2 OS=Arabidopsis thaliana GN=SCPL2 PE=2 SV=1 Back     alignment and function description
>sp|O81009|SCP12_ARATH Serine carboxypeptidase-like 12 OS=Arabidopsis thaliana GN=SCPL12 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAU1|SCP3_ARATH Serine carboxypeptidase-like 3 OS=Arabidopsis thaliana GN=SCPL3 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZU3|SCP19_ARATH Serine carboxypeptidase-like 19 OS=Arabidopsis thaliana GN=SCPL19 PE=1 SV=1 Back     alignment and function description
>sp|Q8RWJ6|SCP1_ARATH Serine carboxypeptidase-like 1 OS=Arabidopsis thaliana GN=SCPL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SQX6|SCP7_ARATH Serine carboxypeptidase-like 7 OS=Arabidopsis thaliana GN=SCPL7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
224056272 469 predicted protein [Populus trichocarpa] 0.917 0.379 0.532 7e-47
255562254 478 serine carboxypeptidase, putative [Ricin 0.927 0.376 0.513 4e-43
296083016 503 unnamed protein product [Vitis vinifera] 0.922 0.355 0.478 7e-42
359475474 468 PREDICTED: serine carboxypeptidase-like 0.922 0.382 0.478 9e-42
255568639 596 serine carboxypeptidase, putative [Ricin 0.855 0.278 0.5 5e-41
225429045 491 PREDICTED: serine carboxypeptidase-like 0.979 0.386 0.479 2e-39
296083020 507 unnamed protein product [Vitis vinifera] 0.979 0.374 0.479 2e-39
255562250 480 serine carboxypeptidase, putative [Ricin 0.958 0.387 0.458 5e-39
225429053 488 PREDICTED: serine carboxypeptidase-like 0.963 0.383 0.458 6e-39
296083015 463 unnamed protein product [Vitis vinifera] 0.963 0.403 0.458 9e-39
>gi|224056272|ref|XP_002298786.1| predicted protein [Populus trichocarpa] gi|222846044|gb|EEE83591.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  192 bits (487), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 122/182 (67%), Gaps = 4/182 (2%)

Query: 1   MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRM 60
           ++DTLSA + Y FLRKWL+ H  FL NPLY+AGDSYSG + PI+VQEISDG + G +P M
Sbjct: 140 VSDTLSAAETYEFLRKWLVDHPRFLTNPLYVAGDSYSGIVAPIIVQEISDGNEVGRQPTM 199

Query: 61  NLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKAD 120
           NLKGY+LGNP+TD +ID NS + FA+L ALI+ ++Y+S  KNCKG+Y+N D  N  C  D
Sbjct: 200 NLKGYVLGNPLTDHEIDTNSIVPFAHLKALISDKLYESFMKNCKGEYLNPDQSNASCMED 259

Query: 121 LQNISACTGNVNGGNIYEPKCSFVSPKPTRLSPRDGSVVEDEEDYLDLLFLPAQPAPKLW 180
           +  I  C GNV  G I EP C  +SPKP  L      ++ D+ D   LL  P  P P  W
Sbjct: 260 ILAIKECIGNVFTGQILEPACKEISPKPVALKWDPRFLIADDADI--LLSRPRVPGP--W 315

Query: 181 CR 182
           CR
Sbjct: 316 CR 317

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255562254|ref|XP_002522135.1| serine carboxypeptidase, putative [Ricinus communis] gi|223538734|gb|EEF40335.1| serine carboxypeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296083016|emb|CBI22420.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359475474|ref|XP_002266354.2| PREDICTED: serine carboxypeptidase-like 18-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255568639|ref|XP_002525293.1| serine carboxypeptidase, putative [Ricinus communis] gi|223535451|gb|EEF37121.1| serine carboxypeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225429045|ref|XP_002265842.1| PREDICTED: serine carboxypeptidase-like 18 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296083020|emb|CBI22424.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255562250|ref|XP_002522133.1| serine carboxypeptidase, putative [Ricinus communis] gi|223538732|gb|EEF40333.1| serine carboxypeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225429053|ref|XP_002269439.1| PREDICTED: serine carboxypeptidase-like 18-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296083015|emb|CBI22419.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
TAIR|locus:2197309 452 scpl6 "serine carboxypeptidase 0.747 0.320 0.489 6.7e-33
TAIR|locus:2082239435 scpl16 "serine carboxypeptidas 0.747 0.333 0.468 8.5e-33
TAIR|locus:2059175435 SCPL12 "serine carboxypeptidas 0.747 0.333 0.475 2.3e-32
TAIR|locus:2197294441 scpl2 "serine carboxypeptidase 0.747 0.328 0.475 3.7e-32
TAIR|locus:2082249437 scpl17 "serine carboxypeptidas 0.737 0.327 0.454 4.7e-32
TAIR|locus:2197304441 scpl3 "serine carboxypeptidase 0.747 0.328 0.462 5.4e-31
TAIR|locus:2075755437 SCPL7 "serine carboxypeptidase 0.747 0.331 0.448 3e-30
TAIR|locus:2158946441 scpl1 "serine carboxypeptidase 0.747 0.328 0.462 3e-30
TAIR|locus:2045389 437 SCPL9 "serine carboxypeptidase 0.721 0.320 0.45 4.9e-30
TAIR|locus:2045384 437 scpl10 "serine carboxypeptidas 0.721 0.320 0.457 7.9e-30
TAIR|locus:2197309 scpl6 "serine carboxypeptidase-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 359 (131.4 bits), Expect = 6.7e-33, P = 6.7e-33
 Identities = 71/145 (48%), Positives = 95/145 (65%)

Query:     2 NDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMN 61
             +DT  A +I+ FL+KWL  H +F +NP Y+ GDSYSG  VP  VQEIS G     KP +N
Sbjct:   151 SDTGEAKRIHEFLQKWLGKHQEFSSNPFYVGGDSYSGITVPATVQEISKGNYQCCKPPIN 210

Query:    62 LKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADL 121
             L+GYMLGNP+TD KID NS+I +A+  ALI+ E+Y+S K+ CKG+Y +VDP N  C   L
Sbjct:   211 LQGYMLGNPITDSKIDGNSQIPYAHGMALISDELYESLKRICKGEYEHVDPYNTECLKLL 270

Query:   122 QNISACTGNVNGGNIYEPKCSFVSP 146
             +  + CT  +   +I  P C   +P
Sbjct:   271 EEFNECTSKLYRSHILYPLCEMTNP 295
GO:0004185 "serine-type carboxypeptidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
TAIR|locus:2082239 scpl16 "serine carboxypeptidase-like 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059175 SCPL12 "serine carboxypeptidase-like 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197294 scpl2 "serine carboxypeptidase-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082249 scpl17 "serine carboxypeptidase-like 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197304 scpl3 "serine carboxypeptidase-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075755 SCPL7 "serine carboxypeptidase-like 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158946 scpl1 "serine carboxypeptidase-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045389 SCPL9 "serine carboxypeptidase-like 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045384 scpl10 "serine carboxypeptidase-like 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.16LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
pfam00450 415 pfam00450, Peptidase_S10, Serine carboxypeptidase 6e-43
PLN02209 437 PLN02209, PLN02209, serine carboxypeptidase 2e-37
PLN02213 319 PLN02213, PLN02213, sinapoylglucose-malate O-sinap 1e-35
PLN03016 433 PLN03016, PLN03016, sinapoylglucose-malate O-sinap 2e-35
PTZ00472 462 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1) 2e-10
>gnl|CDD|215926 pfam00450, Peptidase_S10, Serine carboxypeptidase Back     alignment and domain information 
 Score =  147 bits (374), Expect = 6e-43
 Identities = 64/156 (41%), Positives = 85/156 (54%), Gaps = 3/156 (1%)

Query: 2   NDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMN 61
           +D  +A   Y FL+K+     ++  NP YIAG+SY+G  VP + QEI DG   G  P +N
Sbjct: 109 DDEETAKDNYEFLQKFFEKFPEYKNNPFYIAGESYAGHYVPALAQEILDGNKKGTGPNIN 168

Query: 62  LKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADL 121
           LKG ++GN +TD  I  NS I FAY + LI+ E+Y+S KK C G Y + DP N  C   +
Sbjct: 169 LKGVLIGNGLTDPAIQYNSYIPFAYYHGLISDELYESLKKACCGKYPDCDPANTKCLNLV 228

Query: 122 QNISAC---TGNVNGGNIYEPKCSFVSPKPTRLSPR 154
           +  S C    G +N  NIY P C   S      S  
Sbjct: 229 EEASGCNAYNGGINPYNIYTPCCYNSSLSLNPSSTD 264

Length = 415
>gnl|CDD|177859 PLN02209, PLN02209, serine carboxypeptidase Back     alignment and domain information
>gnl|CDD|165857 PLN02213, PLN02213, sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>gnl|CDD|178590 PLN03016, PLN03016, sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>gnl|CDD|240429 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 194
KOG1282 454 consensus Serine carboxypeptidases (lysosomal cath 100.0
PLN02213 319 sinapoylglucose-malate O-sinapoyltransferase/ carb 100.0
PLN03016 433 sinapoylglucose-malate O-sinapoyltransferase 100.0
PLN02209 437 serine carboxypeptidase 100.0
PF00450 415 Peptidase_S10: Serine carboxypeptidase; InterPro: 99.97
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 99.96
KOG1283 414 consensus Serine carboxypeptidases [Posttranslatio 99.82
COG2939 498 Carboxypeptidase C (cathepsin A) [Amino acid trans 99.81
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 93.31
PLN02454414 triacylglycerol lipase 92.13
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 91.23
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 90.82
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 90.32
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 90.23
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 90.22
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 90.12
TIGR03611257 RutD pyrimidine utilization protein D. This protei 89.43
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 89.22
PLN02385349 hydrolase; alpha/beta fold family protein 87.92
PHA02857276 monoglyceride lipase; Provisional 87.87
PLN02571413 triacylglycerol lipase 87.21
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 86.46
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 86.19
PLN02753531 triacylglycerol lipase 86.14
PLN02719518 triacylglycerol lipase 85.64
PLN02298330 hydrolase, alpha/beta fold family protein 85.61
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 84.99
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 84.08
PRK10749330 lysophospholipase L2; Provisional 83.83
PRK05077414 frsA fermentation/respiration switch protein; Revi 83.21
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 82.83
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 82.22
PRK10162318 acetyl esterase; Provisional 82.18
PLN02652395 hydrolase; alpha/beta fold family protein 81.68
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 80.98
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 80.87
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 80.7
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 80.51
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-39  Score=292.69  Aligned_cols=143  Identities=40%  Similarity=0.727  Sum_probs=134.0

Q ss_pred             CChHHHHHHHHHHHHHHHHHccCCCCCCeEEEccccCceehhHHHHHHHhcccCCCCCccccceeEecCCCCChhhhhhH
Q 029400            1 MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNS   80 (194)
Q Consensus         1 ~~d~~~a~~~~~FL~~f~~~fPe~~~~~~yI~GESYaG~yvP~la~~I~~~n~~g~~~~inLkGi~IGNg~td~~~q~~s   80 (194)
                      ++|+.+|+|++.||++||++||||++|||||+||||||||||+||++|+++|+....+.|||||++||||+||+..|.++
T Consensus       142 ~~D~~~A~d~~~FL~~wf~kfPey~~~~fyI~GESYAG~YVP~La~~I~~~N~~~~~~~iNLkG~~IGNg~td~~~~~~~  221 (454)
T KOG1282|consen  142 TGDDGTAKDNYEFLQKWFEKFPEYKSNDFYIAGESYAGHYVPALAQEILKGNKKCCKPNINLKGYAIGNGLTDPEIDYNG  221 (454)
T ss_pred             CCcHHHHHHHHHHHHHHHHhChhhcCCCeEEecccccceehHHHHHHHHhccccccCCcccceEEEecCcccCccccccc
Confidence            58999999999999999999999999999999999999999999999999998766789999999999999999999999


Q ss_pred             HHHHhhhccccCHHHHHHHHhhchh---ccccCCCCchhHHHHHHHHH-HhcCCCCcccCCCCCCCC
Q 029400           81 KIQFAYLNALITYEIYKSAKKNCKG---DYVNVDPGNYLCKADLQNIS-ACTGNVNGGNIYEPKCSF  143 (194)
Q Consensus        81 ~~~fa~~~glIsd~~y~~~~~~C~~---~~~~~~~~~~~C~~a~~~~~-~~~~~in~YdI~~~~C~~  143 (194)
                      +++|+|+||||||++|+.+++.|..   ++.+..+.+..|..+++.+. +...+++.|+|+.+.|..
T Consensus       222 ~~~~a~~h~liSde~~~~l~~~C~~~~~~~~~~~~~~~~C~~~~~~~~~~~~~~i~~y~i~~~~C~~  288 (454)
T KOG1282|consen  222 RIPFAWGHGLISDELYESLKRACDFSSDNYANVDPSNTKCNKAVEEFDSKTTGDIDNYYILTPDCYP  288 (454)
T ss_pred             hhhhhhhcccCCHHHHHHHHHHhccCcccccccCCchhHHHHHHHHHHHHHhccCchhhhcchhhcc
Confidence            9999999999999999999999987   45555666789999999998 777899999999999986

>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
1bcr_A263 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 8e-14
1whs_A255 Structure Of The Complex Of L-Benzylsuccinate With 2e-13
3sc2_A259 Refined Atomic Model Of Wheat Serine Carboxypeptida 2e-13
1wht_A256 Structure Of The Complex Of L-Benzylsuccinate With 2e-13
1ivy_A 452 Physiological Dimer Hpp Precursor Length = 452 7e-09
4az0_A300 Crystal Structure Of Cathepsin A, Complexed With 8a 1e-08
1gxs_A270 Crystal Structure Of Hydroxynitrile Lyase From Sorg 8e-07
>pdb|1BCR|A Chain A, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 263 Back     alignment and structure 
Iteration: 1

 Score = 73.2 bits (178), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 72/144 (50%), Gaps = 8/144 (5%)
Query: 3   DTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNL 62
           D  +A   Y FL KW      +     YIAG+SY+G  VP    E+S  +     P +NL
Sbjct: 126 DNRTAHDSYAFLAKWFERFPHYKYRDFYIAGESYAGHYVP----ELSQLVHRSKNPVINL 181
Query: 63  KGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGD-YVNVDPGNYLCKADL 121
           KG+M+GN + DD  D     +F + + +++ + Y+  K+ C  D +++  P    C A  
Sbjct: 182 KGFMVGNGLIDDYHDYVGTFEFWWNHGIVSDDTYRRLKEACLHDSFIHPSPA---CDAAT 238
Query: 122 QNISACTGNVNGGNIYEPKCSFVS 145
              +A  GN++  ++Y P C+  S
Sbjct: 239 DVATAEQGNIDMYSLYTPVCNITS 262
>pdb|1WHS|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 255 Back     alignment and structure
>pdb|3SC2|A Chain A, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|1WHT|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 256 Back     alignment and structure
>pdb|1IVY|A Chain A, Physiological Dimer Hpp Precursor Length = 452 Back     alignment and structure
>pdb|4AZ0|A Chain A, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 300 Back     alignment and structure
>pdb|1GXS|A Chain A, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 270 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 1e-48
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 3e-46
1ivy_A 452 Human protective protein; carboxypeptidase, serine 1e-40
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 2e-24
1cpy_A 421 Serine carboxypeptidase; hydrolase (carboxypeptida 3e-24
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Length = 255 Back     alignment and structure
 Score =  158 bits (401), Expect = 1e-48
 Identities = 41/142 (28%), Positives = 67/142 (47%), Gaps = 6/142 (4%)

Query: 1   MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRM 60
             D  +A   Y FL KW      +     YIAG+SY+G  VP + Q +         P +
Sbjct: 119 SGDNRTAHDSYAFLAKWFERFPHYKYRDFYIAGESYAGHYVPELSQLVHRS----KNPVI 174

Query: 61  NLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKAD 120
           NLKG+M+GN + DD  D     +F + + +++ + Y+  K+ C  D       +  C A 
Sbjct: 175 NLKGFMVGNGLIDDYHDYVGTFEFWWNHGIVSDDTYRRLKEACLHDS--FIHPSPACDAA 232

Query: 121 LQNISACTGNVNGGNIYEPKCS 142
               +A  GN++  ++Y P C+
Sbjct: 233 TDVATAEQGNIDMYSLYTPVCN 254
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 270 Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Length = 452 Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Length = 483 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Length = 421 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 100.0
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 100.0
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 100.0
1ivy_A 452 Human protective protein; carboxypeptidase, serine 99.97
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 99.96
1cpy_A 421 Serine carboxypeptidase; hydrolase (carboxypeptida 99.96
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 93.76
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 93.23
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 92.27
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 91.99
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 91.92
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 91.68
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 91.53
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 91.38
3h04_A275 Uncharacterized protein; protein with unknown func 91.19
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 90.83
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 90.78
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 90.76
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 90.72
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 90.59
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 90.17
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 90.13
3llc_A270 Putative hydrolase; structural genomics, joint cen 89.83
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 89.77
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 89.44
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 89.04
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 88.94
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 88.7
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 88.65
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 88.28
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 88.26
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 88.25
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 88.25
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 88.1
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 88.08
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 87.91
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 87.56
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 87.43
3ain_A323 303AA long hypothetical esterase; carboxylesterase 87.37
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 87.15
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 86.99
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 86.86
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 86.67
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 86.66
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 86.59
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 86.4
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 86.32
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 86.29
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 86.13
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 86.01
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 85.9
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 85.88
1vkh_A273 Putative serine hydrolase; structural genomics, jo 85.61
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 85.24
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 85.22
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 85.21
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 84.98
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 84.87
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 84.84
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 84.75
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 84.52
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 84.33
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 83.9
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 83.83
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 83.73
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 83.72
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 83.36
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 83.34
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 83.17
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 82.9
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 82.55
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 82.49
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 82.49
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 82.45
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 82.3
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 82.1
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 81.93
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 81.85
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 81.65
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 81.2
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 81.01
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 80.88
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 80.62
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 80.57
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 80.39
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 80.28
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 80.28
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 80.03
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-36  Score=255.48  Aligned_cols=136  Identities=30%  Similarity=0.550  Sum_probs=126.3

Q ss_pred             CChHHHHHHHHHHHHHHHHHccCCCCCCeEEEccccCceehhHHHHHHHhcccCCCCCccccceeEecCCCCChhhhhhH
Q 029400            1 MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNS   80 (194)
Q Consensus         1 ~~d~~~a~~~~~FL~~f~~~fPe~~~~~~yI~GESYaG~yvP~la~~I~~~n~~g~~~~inLkGi~IGNg~td~~~q~~s   80 (194)
                      ++|+++|+|+++||++||++||+|+++||||+||||||||||.+|++|.++|    .+.|||||++||||++|+..|.++
T Consensus       119 ~~~~~~a~~~~~fl~~f~~~fp~~~~~~~yi~GESYgG~yvp~la~~i~~~n----~~~inLkGi~ign~~~d~~~~~~~  194 (255)
T 1whs_A          119 SGDNRTAHDSYAFLAKWFERFPHYKYRDFYIAGESYAGHYVPELSQLVHRSK----NPVINLKGFMVGNGLIDDYHDYVG  194 (255)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHCGGGTTCEEEEEEEETHHHHHHHHHHHHHHHT----CSSCEEEEEEEEEECCBHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHhCHHhcCCCEEEEecCCccccHHHHHHHHHHcC----CcccccceEEecCCccCHHHhhhh
Confidence            4789999999999999999999999999999999999999999999999998    357999999999999999999999


Q ss_pred             HHHHhhhccccCHHHHHHHHhhchhccccCCCCchhHHHHHHHHHHhcCCCCcccCCCCCCC
Q 029400           81 KIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISACTGNVNGGNIYEPKCS  142 (194)
Q Consensus        81 ~~~fa~~~glIsd~~y~~~~~~C~~~~~~~~~~~~~C~~a~~~~~~~~~~in~YdI~~~~C~  142 (194)
                      +++|++.+|+|++++++.+++.|+....  .+.+..|..+++.+.+.++++|+|||+.|.|.
T Consensus       195 ~~~~a~~~gli~~~~~~~~~~~C~~~~~--~~~~~~C~~~~~~~~~~~~~in~YdI~~~~C~  254 (255)
T 1whs_A          195 TFEFWWNHGIVSDDTYRRLKEACLHDSF--IHPSPACDAATDVATAEQGNIDMYSLYTPVCN  254 (255)
T ss_dssp             HHHHHHTTTCSCHHHHHHHHHHHTTSCS--SSCCHHHHHHHHHHHHHHCSSCTTSTTSCCCC
T ss_pred             HHHHHHHcCCCCHHHHHHHHHhcccccc--CCchHHHHHHHHHHHHHhCCCChhhcCCCCCC
Confidence            9999999999999999999999986532  35667899999999988999999999998893
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 194
g1wht.1 409 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat 1e-22
d1ivya_ 452 c.69.1.5 (A:) Human 'protective protein', HPP {Hum 7e-22
d1ac5a_ 483 c.69.1.5 (A:) Serine carboxypeptidase II {Baker's 2e-20
g1gxs.1 425 c.69.1.5 (A:,B:) Hydroxynitrile lyase {Sorghum (So 4e-19
d1wpxa1 421 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Bak 1e-13
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Length = 452 Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Length = 483 Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 421 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
g1wht.1 409 Serine carboxypeptidase II {Wheat (Triticum vulgar 99.97
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 99.96
d1wpxa1 421 Serine carboxypeptidase II {Baker's yeast (Sacchar 99.93
d1ac5a_ 483 Serine carboxypeptidase II {Baker's yeast (Sacchar 99.93
g1gxs.1 425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 99.92
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 91.46
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 88.96
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 88.56
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 88.44
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 88.43
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 88.36
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 88.0
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 87.94
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 87.53
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 86.72
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 83.67
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 83.0
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 80.24
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure