Citrus Sinensis ID: 029412


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MIDFSRVQKELQECSKDIEASGIKVTPVSDNLVHLTGIIPGPVGTPYEGGTFRLDITLPDGYPFEPPKMHFVTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPAPDDPQDAVVAQQYLKDHQTFLSTARYWTESFAKTSSLGVEEKVQKLVEMGFPESQVRSTLEIVGGDENMALEKLLSS
ccccHHHHHHHHHHHccccccccEEEEccccccEEEEEEEccccccccccEEEEEEEccccccccccEEEECccccccccccccccEEEEcccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHcc
**DFSRVQKELQECSKDIEASGIKVTPVSDNLVHLTGIIPGPVGTPYEGGTFRLDITLPDGYPFEPPKMHFVTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPAPDDPQDAVVAQQYLKDHQTFLSTARYWTESFAKTSSLGVEEKVQKLVEMGFPESQVRSTLEIVGGDENMALEKLLS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIDFSRVQKELQECSKDIEASGIKVTPVSDNLVHLTGIIPGPVGTPYEGGTFRLDITLPDGYPFEPPKMHFVTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPAPDDPQDAVVAQQYLKDHQTFLSTARYWTESFAKTSSLGVEEKVQKLVEMGFPESQVRSTLEIVGGDENMALEKLLSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-conjugating enzyme E2 27 Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.confidentQ9FI61
Ubiquitin-conjugating enzyme E2 K Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, in the presence or in the absence of BRCA1-BARD1 E3 ubiquitin-protein ligase complex, catalyzes the synthesis of 'Lys-48'-linked polyubiquitin chains. Does not transfer ubiquitin directly to but elongates monoubiquitinated substrate protein. Mediates the selective degradation of short-lived and abnormal proteins, such as the endoplasmic reticulum-associated degradation (ERAD) of misfolded lumenal proteins. Ubiquitinates huntingtin. May mediate foam cell formation by the suppression of apoptosis of lipid-bearing macrophages through ubiquitination and subsequence degradation of p53/TP53. Proposed to be involved in ubiquitination and proteolytic processing of NF-kappa-B; in vitro supports ubiquitination of NFKB1. Involved in stabilization of CASP12 during ER stress-mediated beta-amyloid neurotoxicity probably by inhibiting proteasome activity; in vitro ubiquitinates CASP12.probableP61087
Ubiquitin-conjugating enzyme E2 K Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, in the presence or in the absence of BRCA1-BARD1 E3 ubiquitin-protein ligase complex, catalyzes the synthesis of 'Lys-48'-linked polyubiquitin chains. Does not transfer ubiquitin directly to but elongates monoubiquitinated substrate protein. Mediates the selective degradation of short-lived and abnormal proteins, such as the endoplasmic reticulum-associated degradation (ERAD) of misfolded lumenal proteins. Ubiquitinates huntingtin. May mediate foam cell formation by the suppression of apoptosis of lipid-bearing macrophages through ubiquitination and subsequence degradation of p53/TP53. Proposed to be involved in ubiquitination and proteolytic processing of NF-kappa-B; in vitro supports ubiquitination of NFKB1. In case of infection by cytomegaloviruses may be involved in the US11-dependent degradation of MHC class I heavy chains following their export from the ER to the cytosol. In case of viral infections may be involved in the HPV E7 protein-dependent degradation of RB1.probableP61086

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.19Ubiquitin--protein ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E46, chain A
Confidence level:very confident
Coverage over the Query: 3-194
View the alignment between query and template
View the model in PyMOL