Citrus Sinensis ID: 029421

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190---
MAAGAGKCFLVTGPPGVGKTTLIMRVLESLKASNPSLKVQGFYTGEIRQGGQRVGFEVVTLDDRRAPLASINASSPESYRWPTVGRYKVDVASFEAIALPELQVGADTDLFVIDEVGKMELFSSSFFPAVLRILESNIPVLASIPAPKSGRDIPAVARLRNHPGATIFTLSPGNRDSLKDNIYYQLTDAVSKH
cccccccEEEEEccccccHHHHHHHHHHHHHHcccccEEEEEECcCEECccCEEcEEEEECcccccccccccccccccccccCCccEEEcHHHHHHHHHHHHHccccccEEEEEccccccccccHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHccccCEEEEEccccHHHHHHHHHHHHHHHHHcc
*****GKCFLVTGPPGVGKTTLIMRVLESLKASNPSLKVQGFYTGEIRQGGQRVGFEVVTLDDRRAPLASINASSPESYRWPTVGRYKVDVASFEAIALPELQVGADTDLFVIDEVGKMELFSSSFFPAVLRILESNIPVLASIPAPKSGRDIPAVARLRNHPGATIFTLSPGNRDSLKDNIYYQLTDAVS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAGAGKCFLVTGPPGVGKTTLIMRVLESLKASNPSLKVQGFYTGEIRQGGQRVGFEVVTLDDRRAPLASINASSPESYRWPTVGRYKVDVASFEAIALPELQVGADTDLFVIDEVGKMELFSSSFFPAVLRILESNIPVLASIPAPKSGRDIPAVARLRNHPGATIFTLSPGNRDSLKDNIYYQLTDAVSKH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nucleoside-triphosphatase THEP1 Has nucleotide phosphatase activity towards ATP, GTP, CTP, TTP and UTP. May hydrolyze nucleoside diphosphates with lower efficiency.probableQ467J7
Cancer-related nucleoside-triphosphatase Has nucleotide phosphatase activity towards ATP, GTP, CTP, TTP and UTP. Hydrolyzes nucleoside diphosphates with lower efficiency.probableQ9BSD7
Nucleoside-triphosphatase THEP1 Has nucleotide phosphatase activity towards ATP, GTP, CTP, TTP and UTP. May hydrolyze nucleoside diphosphates with lower efficiency.probableO58522

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.1.-In phosphorous-containing anhydrides.probable
3.6.1.15Nucleoside-triphosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I3B, chain A
Confidence level:very confident
Coverage over the Query: 6-189
View the alignment between query and template
View the model in PyMOL