Citrus Sinensis ID: 029423
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 193 | ||||||
| 255574272 | 336 | conserved hypothetical protein [Ricinus | 0.937 | 0.538 | 0.755 | 8e-75 | |
| 225453070 | 340 | PREDICTED: methyltransferase-like protei | 0.948 | 0.538 | 0.723 | 1e-73 | |
| 147767550 | 808 | hypothetical protein VITISV_013343 [Viti | 0.948 | 0.226 | 0.701 | 2e-71 | |
| 356499626 | 342 | PREDICTED: methyltransferase-like protei | 0.963 | 0.543 | 0.728 | 2e-71 | |
| 356569031 | 342 | PREDICTED: methyltransferase-like protei | 0.963 | 0.543 | 0.728 | 9e-71 | |
| 357508247 | 340 | Methyltransferase-like protein [Medicago | 0.943 | 0.535 | 0.710 | 2e-70 | |
| 224124078 | 342 | predicted protein [Populus trichocarpa] | 0.948 | 0.535 | 0.764 | 4e-70 | |
| 4760710 | 337 | SLL2-S9-protein [Brassica rapa] | 0.937 | 0.537 | 0.703 | 2e-67 | |
| 78191462 | 240 | SLL2-S9-protein-like [Solanum tuberosum] | 0.937 | 0.754 | 0.686 | 2e-66 | |
| 1518113 | 337 | SLL2 [Brassica napus] | 0.937 | 0.537 | 0.693 | 5e-66 |
| >gi|255574272|ref|XP_002528050.1| conserved hypothetical protein [Ricinus communis] gi|223532511|gb|EEF34300.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 285 bits (728), Expect = 8e-75, Method: Compositional matrix adjust.
Identities = 142/188 (75%), Positives = 157/188 (83%), Gaps = 7/188 (3%)
Query: 1 MAGFRLPPEEPEVSPQQPPQQVRVAGDLVSDDERSVAADSWSIKSEYGSTLDDDQRHADA 60
MAG RL PEE ++S QQ GDLVSDDERSVAADSWSIKS+YGSTLDDDQRHADA
Sbjct: 1 MAGIRLLPEEADLSQQQSRGGA-AGGDLVSDDERSVAADSWSIKSDYGSTLDDDQRHADA 59
Query: 61 AEALSSAANFRANSDYNSDKEEPDPEGMASMLGLQSYWDSAYADELANFREHGHAGEVWF 120
AEALSSA NFR SDYNSDKEEPD EG+ SMLGLQSYWDSAYADELANF EHGHAGE+WF
Sbjct: 60 AEALSSATNFRTASDYNSDKEEPDGEGVTSMLGLQSYWDSAYADELANFHEHGHAGEIWF 119
Query: 121 GADVMDVVASWTKSLCISISQGHMLNHVEDLKSEPVEENDKYLSSWSVLDIGTGNGLLLQ 180
G+DVMDVV SWTKSLCI ISQ H+ NHV+ +E++DK L WSVLD+GTGNGLLLQ
Sbjct: 120 GSDVMDVVVSWTKSLCIRISQDHISNHVD------IEQDDKCLPYWSVLDLGTGNGLLLQ 173
Query: 181 ELSKQGYT 188
EL+KQG++
Sbjct: 174 ELAKQGFS 181
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225453070|ref|XP_002269621.1| PREDICTED: methyltransferase-like protein 10 isoform 1 [Vitis vinifera] gi|296087211|emb|CBI33585.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147767550|emb|CAN75639.1| hypothetical protein VITISV_013343 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356499626|ref|XP_003518638.1| PREDICTED: methyltransferase-like protein 10-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356569031|ref|XP_003552710.1| PREDICTED: methyltransferase-like protein 10-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357508247|ref|XP_003624412.1| Methyltransferase-like protein [Medicago truncatula] gi|355499427|gb|AES80630.1| Methyltransferase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224124078|ref|XP_002330099.1| predicted protein [Populus trichocarpa] gi|222871233|gb|EEF08364.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|4760710|dbj|BAA77395.1| SLL2-S9-protein [Brassica rapa] | Back alignment and taxonomy information |
|---|
| >gi|78191462|gb|ABB29952.1| SLL2-S9-protein-like [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|1518113|gb|AAB49423.1| SLL2 [Brassica napus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 193 | ||||||
| TAIR|locus:2033329 | 358 | AR401 [Arabidopsis thaliana (t | 0.829 | 0.446 | 0.641 | 7e-54 | |
| UNIPROTKB|Q5JPI9 | 291 | METTL10 "Methyltransferase-lik | 0.279 | 0.185 | 0.436 | 1.1e-14 | |
| ZFIN|ZDB-GENE-050306-30 | 233 | mettl10 "methyltransferase lik | 0.253 | 0.210 | 0.428 | 3.1e-12 | |
| WB|WBGene00017919 | 236 | F29B9.1 [Caenorhabditis elegan | 0.227 | 0.186 | 0.5 | 1.2e-11 | |
| MGI|MGI:1919346 | 244 | Mettl10 "methyltransferase lik | 0.217 | 0.172 | 0.428 | 3.7e-11 | |
| POMBASE|SPBC839.14c | 238 | SPBC839.14c "methyltransferase | 0.217 | 0.176 | 0.428 | 2.1e-05 |
| TAIR|locus:2033329 AR401 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 557 (201.1 bits), Expect = 7.0e-54, P = 7.0e-54
Identities = 104/162 (64%), Positives = 126/162 (77%)
Query: 28 LVSDDERSVAADSWSIKSEYGSTLDDDQRHXXXXXXXXXXXXXXXNSDYNSDKEEPDPEG 87
L SDD+RS+AADSWSIKSEYGSTLDDDQRH +SDY+SDKEEPD +G
Sbjct: 33 LASDDDRSIAADSWSIKSEYGSTLDDDQRHADAAEALSSANFRV-SSDYSSDKEEPDADG 91
Query: 88 MA-SMLGLQSYWDSAYADELANFREHGHAGEVWFGADVMDVVASWTKSLCISISQGHMLN 146
SMLGLQSYWD+AY+DEL NFREHGHAGEVWFG DVM++V SWTK LC+ ISQ +M
Sbjct: 92 GGQSMLGLQSYWDAAYSDELTNFREHGHAGEVWFGDDVMEIVTSWTKDLCVEISQRNMSV 151
Query: 147 HVEDLKSEPVEENDKYLSSWSVLDIGTGNGLLLQELSKQGYT 188
D+ +E ++ DKYLSSW+VLD+GTGNGLLL +L+K+G++
Sbjct: 152 SENDVTTEVNDQADKYLSSWNVLDLGTGNGLLLHQLAKEGFS 193
|
|
| UNIPROTKB|Q5JPI9 METTL10 "Methyltransferase-like protein 10" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050306-30 mettl10 "methyltransferase like 10" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00017919 F29B9.1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919346 Mettl10 "methyltransferase like 10" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC839.14c SPBC839.14c "methyltransferase involved in endocytosis (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 193 | |||
| KOG1271 | 227 | consensus Methyltransferases [General function pre | 99.97 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 97.99 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 97.82 | |
| KOG2352 | 482 | consensus Predicted spermine/spermidine synthase [ | 97.65 | |
| PF07757 | 112 | AdoMet_MTase: Predicted AdoMet-dependent methyltra | 97.64 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 97.47 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 97.41 | |
| KOG2361 | 264 | consensus Predicted methyltransferase [General fun | 97.4 | |
| PF05724 | 218 | TPMT: Thiopurine S-methyltransferase (TPMT); Inter | 97.37 | |
| PRK13256 | 226 | thiopurine S-methyltransferase; Reviewed | 97.34 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 97.31 | |
| PF08003 | 315 | Methyltransf_9: Protein of unknown function (DUF16 | 97.29 | |
| KOG1270 | 282 | consensus Methyltransferases [Coenzyme transport a | 97.14 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 97.0 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 96.91 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 96.57 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 96.5 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 96.42 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 96.41 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 96.39 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 96.25 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 96.24 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 96.23 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 96.18 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 96.02 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 96.01 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 95.98 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 95.92 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 95.84 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 95.82 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 95.81 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 95.74 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 95.73 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 95.73 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 95.72 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 95.66 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 95.59 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 95.51 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 95.51 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 95.47 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 95.39 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 95.38 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 95.32 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 95.29 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 95.22 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 95.19 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 95.14 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 95.09 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 94.99 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 94.97 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 94.8 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 94.8 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 94.76 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 94.74 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 94.7 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 94.68 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 94.63 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 94.61 | |
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 94.53 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 94.45 | |
| PF13679 | 141 | Methyltransf_32: Methyltransferase domain | 94.44 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 94.42 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 94.41 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 94.39 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 94.35 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 94.2 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 94.09 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 94.02 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 94.02 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 93.82 | |
| PRK04266 | 226 | fibrillarin; Provisional | 93.69 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 93.6 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 93.52 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 93.37 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 93.36 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 93.36 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 93.35 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 93.34 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 93.13 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 92.96 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 92.91 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 92.72 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 92.63 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 92.62 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 92.61 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 92.54 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 92.51 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 92.41 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 92.32 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 92.3 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 92.28 | |
| COG0220 | 227 | Predicted S-adenosylmethionine-dependent methyltra | 92.26 | |
| KOG1541 | 270 | consensus Predicted protein carboxyl methylase [Ge | 91.98 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 91.88 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 91.87 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 91.73 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 91.7 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 91.66 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 91.51 | |
| KOG1499 | 346 | consensus Protein arginine N-methyltransferase PRM | 91.2 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 90.9 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 90.61 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 90.43 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 90.41 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 90.39 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 90.26 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 89.55 | |
| PF10294 | 173 | Methyltransf_16: Putative methyltransferase; Inter | 88.84 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 88.67 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 88.28 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 87.86 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 87.8 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 87.38 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 87.33 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 87.22 | |
| PF03291 | 331 | Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 | 86.81 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 85.92 | |
| KOG2798 | 369 | consensus Putative trehalase [Carbohydrate transpo | 85.19 | |
| PF00891 | 241 | Methyltransf_2: O-methyltransferase; InterPro: IPR | 85.05 | |
| COG0500 | 257 | SmtA SAM-dependent methyltransferases [Secondary m | 85.04 | |
| PLN02366 | 308 | spermidine synthase | 84.74 | |
| PF02384 | 311 | N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T | 83.85 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 83.69 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 83.21 | |
| PF05148 | 219 | Methyltransf_8: Hypothetical methyltransferase; In | 82.8 | |
| PF03141 | 506 | Methyltransf_29: Putative S-adenosyl-L-methionine- | 82.42 | |
| PF07942 | 270 | N2227: N2227-like protein; InterPro: IPR012901 Thi | 82.34 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 82.15 | |
| PF08123 | 205 | DOT1: Histone methylation protein DOT1 ; InterPro: | 81.32 | |
| KOG2899 | 288 | consensus Predicted methyltransferase [General fun | 81.21 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 81.19 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 80.39 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 80.33 | |
| TIGR02987 | 524 | met_A_Alw26 type II restriction m6 adenine DNA met | 80.13 |
| >KOG1271 consensus Methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.97 E-value=4.5e-31 Score=224.69 Aligned_cols=94 Identities=50% Similarity=0.886 Sum_probs=82.0
Q ss_pred CCCCCCCCCCCCCCCCCcHHHHHHHHhhhhhhhccCCCCCceecCCchHHHHHHHHHhhhhhhccCcccccccccCCCcc
Q 029423 77 NSDKEEPDPEGMASMLGLQSYWDSAYADELANFREHGHAGEVWFGADVMDVVASWTKSLCISISQGHMLNHVEDLKSEPV 156 (193)
Q Consensus 77 ~s~k~e~~~el~pS~LGtkeYWD~~Y~~EL~NF~e~gD~GEiWFGed~~d~vv~Wlk~~~~~i~q~~ip~~~d~~~~e~~ 156 (193)
+||++++ .++..|+||||+|||+.|++|+.||.+|||+||+|||++++.+|++||+.++. +.+ + +
T Consensus 1 ~sdm~~~-adl~~S~LGtK~yWD~~Y~~El~Nfr~hgd~GEvWFg~~ae~riv~wl~d~~~-~~r--v-----------~ 65 (227)
T KOG1271|consen 1 SSDMSEP-ADLGQSKLGTKSYWDAAYELELTNFREHGDEGEVWFGEDAEERIVDWLKDLIV-ISR--V-----------S 65 (227)
T ss_pred CCccccc-ccccccccchHHHHHHHHHHHHhhcccCCCccceecCCcHHHHHHHHHHhhhh-hhh--h-----------c
Confidence 4788888 88999999999999999999999999999999999999999999999998763 221 1 1
Q ss_pred ccccccCCCCceeEeeccChHhHHHHHHCCCcccc
Q 029423 157 EENDKYLSSWSVLDIGTGNGLLLQELSKQGYTLRF 191 (193)
Q Consensus 157 e~~~k~~~~~sILDLGCGNG~LL~eLak~GFs~~l 191 (193)
+ ...+|||||||||+||++|++.||++.|
T Consensus 66 ----~--~A~~VlDLGtGNG~~L~~L~~egf~~~L 94 (227)
T KOG1271|consen 66 ----K--QADRVLDLGTGNGHLLFQLAKEGFQSKL 94 (227)
T ss_pred ----c--cccceeeccCCchHHHHHHHHhcCCCCc
Confidence 1 1238999999999999999999999864
|
|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >KOG2361 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PRK13256 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF13679 Methyltransf_32: Methyltransferase domain | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases | Back alignment and domain information |
|---|
| >PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases | Back alignment and domain information |
|---|
| >PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] | Back alignment and domain information |
|---|
| >KOG2899 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 193 | |||
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 4e-06 |
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
Score = 44.6 bits (105), Expect = 4e-06
Identities = 19/100 (19%), Positives = 25/100 (25%), Gaps = 34/100 (34%)
Query: 89 ASMLGLQSYWDSAYADELANFREHGHAGEVWFGADVMDVVASWTKSLCISISQGHMLNHV 148
S YWD Y A WFG +
Sbjct: 1 GSGYREVEYWDQRYQ------GAADSAPYDWFGDF----------------------SSF 32
Query: 149 EDLKSEPVEENDKYLSSWSVLDIGTGNGLLLQELSKQGYT 188
L + D+ +L +G GN L EL G+
Sbjct: 33 RALLEPELRPEDR------ILVLGCGNSALSYELFLGGFP 66
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 193 | |||
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 98.97 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 98.9 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 98.06 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 98.01 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 97.94 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 97.84 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 97.8 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 97.73 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 97.66 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 97.65 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 97.59 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 97.58 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 97.54 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 97.51 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 97.47 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 97.45 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 97.44 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 97.44 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 97.31 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 97.3 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 97.29 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 97.28 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 97.27 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 97.25 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 97.21 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 97.19 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 97.1 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 97.04 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 97.04 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 96.98 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 96.97 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 96.95 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 96.88 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 96.88 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 96.81 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 96.8 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 96.76 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 96.75 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 96.74 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 96.74 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 96.74 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 96.73 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 96.71 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 96.69 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 96.67 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 96.66 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 96.66 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 96.65 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 96.64 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 96.62 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 96.61 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 96.61 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 96.59 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 96.57 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 96.54 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 96.53 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 96.53 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 96.5 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 96.5 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 96.47 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 96.46 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 96.46 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 96.45 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 96.45 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 96.44 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 96.44 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 96.43 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 96.43 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 96.43 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 96.42 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 96.42 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 96.38 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 96.35 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 96.35 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 96.34 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 96.34 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 96.33 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 96.32 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 96.31 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 96.28 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 96.28 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 96.27 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 96.26 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 96.26 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 96.25 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 96.19 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 96.19 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 96.18 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 96.17 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 96.16 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 96.15 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 96.14 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 96.14 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 96.1 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 96.06 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 96.04 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 96.04 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 96.03 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 96.02 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 95.95 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 95.93 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 95.92 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 95.91 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 95.89 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 95.88 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 95.87 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 95.78 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 95.75 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 95.72 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 95.71 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 95.7 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 95.68 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 95.66 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 95.66 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 95.65 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 95.65 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 95.64 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 95.58 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 95.56 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 95.55 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 95.48 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 95.48 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 95.44 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 95.41 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 95.38 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 95.35 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 95.33 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 95.32 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 95.27 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 95.27 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 95.25 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 95.24 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 95.24 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 95.2 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 95.19 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 95.18 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 95.17 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 95.16 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 95.15 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 95.09 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 95.0 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 94.97 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 94.95 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 94.94 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 94.93 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 94.92 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 94.9 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 94.88 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 94.79 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 94.78 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 94.77 | |
| 2k4m_A | 153 | TR8_protein, UPF0146 protein MTH_1000; alpha+beta, | 94.76 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 94.74 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 94.73 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 94.72 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 94.71 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 94.7 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 94.68 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 94.67 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 94.66 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 94.66 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 94.66 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 94.64 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 94.59 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 94.56 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 94.56 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 94.56 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 94.56 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 94.55 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 94.53 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 94.47 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 94.44 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 94.43 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 94.36 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 94.36 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 94.35 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 94.34 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 94.3 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 94.25 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 94.15 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 94.1 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 94.1 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 94.03 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 93.9 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 93.89 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 93.84 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 93.81 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 93.78 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 93.72 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 93.69 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 93.54 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 93.48 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 93.45 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 93.35 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 93.33 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 93.28 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 93.25 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 93.2 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 93.15 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 93.02 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 92.84 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 92.82 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 92.78 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 92.72 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 92.71 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 92.67 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 92.41 | |
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 92.26 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 92.25 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 92.11 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 92.07 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 91.91 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 91.46 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 90.97 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 90.93 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 90.84 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 90.82 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 90.54 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 90.43 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 90.39 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 90.05 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 89.97 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 89.77 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 89.74 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 88.83 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 88.75 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 88.23 | |
| 1af7_A | 274 | Chemotaxis receptor methyltransferase CHER; chemot | 88.22 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 88.0 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 86.03 | |
| 3lcv_B | 281 | Sisomicin-gentamicin resistance methylase SGM; ant | 85.8 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 85.76 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 85.59 | |
| 3khk_A | 544 | Type I restriction-modification system methylation | 84.43 | |
| 3lkd_A | 542 | Type I restriction-modification system methyltrans | 84.3 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 83.58 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 82.34 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 81.53 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 81.24 | |
| 3b5i_A | 374 | S-adenosyl-L-methionine:salicylic acid carboxyl me | 81.22 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 80.58 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 80.45 |
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
Probab=98.97 E-value=7.1e-10 Score=92.91 Aligned_cols=76 Identities=14% Similarity=0.177 Sum_probs=52.3
Q ss_pred CCCCCCCCCCCCCCcHHHHHHHHhhhhhhhccCCCCCceecCCchHHHHHHHHHhhhhhhccCcccccccccCCCccccc
Q 029423 80 KEEPDPEGMASMLGLQSYWDSAYADELANFREHGHAGEVWFGADVMDVVASWTKSLCISISQGHMLNHVEDLKSEPVEEN 159 (193)
Q Consensus 80 k~e~~~el~pS~LGtkeYWD~~Y~~EL~NF~e~gD~GEiWFGed~~d~vv~Wlk~~~~~i~q~~ip~~~d~~~~e~~e~~ 159 (193)
|+-.+.++.++.+.+++||+++|.++... |........+++|+..+.. +
T Consensus 18 ~~~~~~e~~~~~~~~~~~Wd~~y~~~~~~----------~~~~~~~~~l~~~~~~~~~-------~-------------- 66 (252)
T 2gb4_A 18 KEHPDAEVQKNQVLTLEDWKEKWVTRHIS----------FHQEQGHQLLKKHLDTFLK-------G-------------- 66 (252)
T ss_dssp ----CTTTTTTCCCCHHHHHHHHHHTCCT----------TCCTTCCHHHHHHHHHHHT-------T--------------
T ss_pred cCCCCccccccccCCHHHHHHHHhcCCCC----------cccCCCCHHHHHHHHHhcc-------C--------------
Confidence 34445789999999999999999875332 2222222456677754320 0
Q ss_pred cccCCCCceeEeeccChHhHHHHHHCCCcc
Q 029423 160 DKYLSSWSVLDIGTGNGLLLQELSKQGYTL 189 (193)
Q Consensus 160 ~k~~~~~sILDLGCGNG~LL~eLak~GFs~ 189 (193)
.+..+|||||||+|.++..|++.||..
T Consensus 67 ---~~~~~vLD~GCG~G~~~~~La~~G~~V 93 (252)
T 2gb4_A 67 ---QSGLRVFFPLCGKAIEMKWFADRGHTV 93 (252)
T ss_dssp ---CCSCEEEETTCTTCTHHHHHHHTTCEE
T ss_pred ---CCCCeEEEeCCCCcHHHHHHHHCCCeE
Confidence 135689999999999999999999954
|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 193 | |||
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 98.83 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 98.12 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 98.12 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 98.07 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 97.74 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 97.65 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 97.63 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 97.55 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 97.27 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 97.2 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 97.1 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 97.03 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 96.95 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 96.85 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 96.77 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 96.71 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 96.68 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 96.62 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 96.62 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 96.61 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 96.56 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 96.52 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 96.51 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 96.5 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 96.47 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 96.34 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 96.29 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 96.27 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 96.08 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 96.08 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 96.06 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 96.05 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 95.97 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 95.83 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 95.65 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 95.46 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 95.3 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 95.21 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 94.68 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 94.6 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 94.55 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 94.46 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 94.42 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 94.28 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 94.23 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 94.09 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 93.39 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 93.36 | |
| d1fp1d2 | 244 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 93.23 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 92.14 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 91.97 | |
| d1fp2a2 | 244 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 91.61 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 91.28 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 90.83 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 90.64 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 90.47 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 89.7 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 85.09 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 84.55 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 83.63 |
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Thiopurine S-methyltransferase domain: Thiopurine S-methyltransferase species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.83 E-value=1.7e-09 Score=85.98 Aligned_cols=63 Identities=8% Similarity=0.106 Sum_probs=46.6
Q ss_pred CcHHHHHHHHhhhhhhhccCCCCCceecCCchHHHHHHHHHhhhhhhccCcccccccccCCCccccccccCCCCceeEee
Q 029423 93 GLQSYWDSAYADELANFREHGHAGEVWFGADVMDVVASWTKSLCISISQGHMLNHVEDLKSEPVEENDKYLSSWSVLDIG 172 (193)
Q Consensus 93 GtkeYWD~~Y~~EL~NF~e~gD~GEiWFGed~~d~vv~Wlk~~~~~i~q~~ip~~~d~~~~e~~e~~~k~~~~~sILDLG 172 (193)
-|.++|+++|.+.... |+.+.....+++|+.+.+. + .++.+|||+|
T Consensus 8 ~~~e~W~~~~~~~~~~----------w~~~~~~~~l~~~~~~~l~------~------------------~~~~rvLd~G 53 (229)
T d2bzga1 8 LTLEEWQDKWVNGKTA----------FHQEQGHQLLKKHLDTFLK------G------------------KSGLRVFFPL 53 (229)
T ss_dssp CCHHHHHHHHHHTCCT----------TCCTTCCHHHHHHHHHHHT------T------------------CCSCEEEETT
T ss_pred CCHHHHHHHHccCCCC----------CccCCCCHHHHHHHHHhcC------C------------------CCCCEEEEeC
Confidence 4789999999763222 6666555667777765431 1 2356899999
Q ss_pred ccChHhHHHHHHCCCcc
Q 029423 173 TGNGLLLQELSKQGYTL 189 (193)
Q Consensus 173 CGNG~LL~eLak~GFs~ 189 (193)
||+|.++..|++.||..
T Consensus 54 CG~G~~a~~LA~~G~~V 70 (229)
T d2bzga1 54 CGKAVEMKWFADRGHSV 70 (229)
T ss_dssp CTTCTHHHHHHHTTCEE
T ss_pred CCCcHHHHHHHhCCCcE
Confidence 99999999999999965
|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|