Citrus Sinensis ID: 029437


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190---
MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKKELDALLSDEALANVPFLVLGNKIDIPYAASEEELRYHLGLSNFTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK
cccHHHHHHHHHHccccccEEEEEEEEcccccHHHHHHHHcccccccccccccccEEEEEEccEEEEEEEccccHHHHccHHHHcccccEEEEEEEccccccHHHHHHHHHHHccccccccccEEEEEccccccccccHHHHHHHccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHcc
MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKKELDALLSDEALANVPFLVLGNKIDIPYAASEEELRYHLGLSNFTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKKELDALLSDEALANVPFLVLGNKIDIPYAASEEELRYHLGLSNFTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GTP-binding protein SAR1A Involved in transport from the endoplasmic reticulum to the Golgi apparatus.confidentO04834
GTP-binding protein SAR1B Involved in transport from the endoplasmic reticulum to the Golgi apparatus.confidentO04267
GTP-binding protein SAR1A Involved in transport from the endoplasmic reticulum to the Golgi apparatus.confidentO04266

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F6B, chain A
Confidence level:very confident
Coverage over the Query: 8-193
View the alignment between query and template
View the model in PyMOL